Sterol regulatory element-binding protein 1 (Srebf1) Recombinant Protein | Srebf1 recombinant protein

Recombinant Mouse Sterol regulatory element-binding protein 1 (Srebf1)

Cat. Num. AAA7030451

• Gene Names: Srebf1; ADD1; SREBP1; bHLHd1; SREBP1c; SREBP-1a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sterol regulatory element-binding protein 1 (Srebf1); Recombinant Mouse Sterol regulatory element-binding protein 1 (Srebf1); Srebf1 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-480aa; full length protein
• Sequence: MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTG PSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGI KEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQP PSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKA DSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKA IDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTP PPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLAL
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Mouse
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Srebf1 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 928192571
• NCBI GeneID: 20787
• NCBI Accession #: NP_001300908.1
• NCBI GenBank Nucleotide #: NM_001313979.1
• UniProt Accession #: Q9WTN3; Q3U458; Q3UDJ3; Q5SRX5; Q8C733; Q99JK7
• Molecular Weight: 113,734 Da
• NCBI Official Full Name: sterol regulatory element-binding protein 1 isoform 2
• NCBI Official Synonym Full Names: sterol regulatory element binding transcription factor 1
• NCBI Official Symbol: Srebf1
• NCBI Official Synonym Symbols: ADD1; SREBP1; bHLHd1; SREBP1c; SREBP-1a
• NCBI Protein Information: sterol regulatory element-binding protein 1
• UniProt Protein Name: Sterol regulatory element-binding protein 1
• UniProt Gene Name: Srebf1
• UniProt Synonym Gene Names: Srebp1; SREBP-1
• UniProt Entry Name: SRBP1_MOUSE

NCBI Description

This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

SREBP-1: Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the fatty acid and to a lesser degree the cholesterol synthesis pathway. Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3'). Forms a tight complex with SCAP in the ER membrane. Efficient DNA binding of the soluble transcription factor fragment requires dimerization with another bHLH protein. Interacts with LMNA. Expressed in a wide variety of tissues, most abundant in liver and adrenal gland. In fetal tissues lung and liver shows highest expression. Isoform SREBP-1C predominates in liver, adrenal gland and ovary, whereas isoform SREBP-1A predominates in hepatoma cell lines. Isoform SREBP-1A and isoform SREBP-1C are found in kidney, brain, white fat, and muscle. Belongs to the SREBP family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Membrane protein, multi-pass; Membrane protein, integral; DNA-binding

Cellular Component: cytoplasm; cytoplasmic vesicle; endoplasmic reticulum; Golgi apparatus; integral to membrane; intracellular membrane-bound organelle; membrane; nucleus; protein complex

Molecular Function: chromatin binding; DNA binding; protein binding; protein complex binding; protein dimerization activity; protein kinase binding; sequence-specific DNA binding; sterol response element binding; transcription factor activity

Biological Process: cellular response to starvation; chemical signal regulation of heart rate; cholesterol metabolic process; fat cell differentiation; insulin receptor signaling pathway; lipid biosynthetic process; lipid metabolic process; mRNA transcription from RNA polymerase II promoter; negative regulation of insulin secretion; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cholesterol biosynthetic process; positive regulation of fatty acid biosynthetic process; positive regulation of histone deacetylation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of fatty acid metabolic process; regulation of insulin secretion; regulation of protein stability; regulation of transcription, DNA-dependent; response to glucose stimulus; steroid metabolic process; transcription, DNA-dependent