Rabbit anti-Human TAF15 Polyclonal Antibody | anti-TAF15 antibody

TAF15 (RBP56, TAF2N, TATA-binding Protein-associated Factor 2N, 68kD TATA-binding Protein-associated Factor, RNA-binding Protein 56, TAF(II)68, TAFII68) (AP)

Cat. Num. AAA6395884

• Gene Names: TAF15; Npl3; RBP56; TAF2N; TAFII68
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF15; Polyclonal Antibody; TAF15 (RBP56; TAF2N; TATA-binding Protein-associated Factor 2N; 68kD TATA-binding Protein-associated Factor; RNA-binding Protein 56; TAF(II)68; TAFII68) (AP); anti-TAF15 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TAF15.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TAF15 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TAF15, aa1-592 (NP_631961.1).
• Immunogen Sequence: MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TAF15 expression in transfected 293T cell line by TAF15 polyclonal antibody. Lane 1: TAF15 transfected lysate (61.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(TAF15 rabbit polyclonal antibody. Western Blot analysis of TAF15 expression in human pancreas.)

Related Product Information for anti-TAF15 antibody

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a subunit of TFIID present in a subset of TFIID complexes. Translocations involving chromosome 17 and chromosome 9, where the gene for the nuclear receptor CSMF is located, result in a gene fusion product that is an RNA binding protein associated with a subset of extraskeletal myxoid chondrosarcomas. Two transcripts encoding different isoforms have been identified.

Product Categories/Family for anti-TAF15 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21327701
• NCBI GeneID: 8148
• NCBI Accession #: NP_631961.1
• NCBI GenBank Nucleotide #: NM_139215.1
• UniProt Accession #: Q92804; Q92751; B2R837
• Molecular Weight: 61,830 Da
• NCBI Official Full Name: TATA-binding protein-associated factor 2N isoform 1
• NCBI Official Synonym Full Names: TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
• NCBI Official Symbol: TAF15
• NCBI Official Synonym Symbols: Npl3; RBP56; TAF2N; TAFII68
• NCBI Protein Information: TATA-binding protein-associated factor 2N; RBP56/CSMF fusion; TBP-associated factor 15; TATA box-binding protein-associated factor 2N (RNA-binding protein 56); TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding prote
• UniProt Protein Name: TATA-binding protein-associated factor 2N
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF15
• UniProt Synonym Gene Names: RBP56; TAF2N; TAF(II)68; TAFII68
• UniProt Entry Name: RBP56_HUMAN

Uniprot Description

TAF15: RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Can enter the preinitiation complex together with the RNA polymerase II (Pol II). A chromosomal aberration involving TAF15/TAF2N is found in a form of extraskeletal myxoid chondrosarcomas (EMC). Translocation t(9;17)(q22;q11) with NR4A3. Belongs to the RRM TET family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation; Oncoprotein; RNA-binding

Chromosomal Location of Human Ortholog: 17q11.1-q11.2

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; nucleotide binding

Biological Process: positive regulation of transcription, DNA-dependent

Disease: Chondrosarcoma, Extraskeletal Myxoid