Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page ()

KRT19 recombinant protein

Purified recombinant KRT19 protein

Applications
ELISA, SDS-Page, Western Blot
Purity
> 90% pure
Synonyms
KRT19; Purified recombinant KRT19 protein; KRT19 protein; KRT19 recombinant protein
Ordering
Host
Human
Purity/Purification
> 90% pure
Form/Format
Supplied in liquid form in 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin (pH 8.0) and 200 mM Imidazole
Sequence
KFLEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKRAENS
Sequence Length
400
Applicable Applications for KRT19 recombinant protein
ELISA (EIA), SDS-PAGE, Western Blot (WB)
Expression
E Coli
Preparation and Storage
Store at 4 degree C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 degree C, avoid repeat freeze/thaw cycles.

SDS-Page

()

SDS-Page ()
Product Categories/Family for KRT19 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,065 Da
NCBI Official Full Name
keratin, type I cytoskeletal 19
NCBI Official Symbol
KRT19
NCBI Protein Information
keratin, type I cytoskeletal 19
UniProt Protein Name
Keratin, type I cytoskeletal 19
Protein Family
UniProt Gene Name
KRT19
UniProt Synonym Gene Names
CK-19; K19

Uniprot Description

Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle ().

Similar Products

Product Notes

The KRT19 krt19 (Catalog #AAA5308785) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KRT19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), SDS-PAGE, Western Blot (WB). Researchers should empirically determine the suitability of the KRT19 krt19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KFLEGAVLPR SAKELRCQCI KTYSKPFHPK FIKELRVIES GPHCANTEII VKLSDGRELC LDPKENWVQR VVEKRAENS. It is sometimes possible for the material contained within the vial of "KRT19, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.