Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2) Recombinant Protein | SRD5A2 recombinant protein

Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2); Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2); Recombinant 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2 EC= 1.3.99.5; 5 alpha-SR2 SR type 2 Steroid 5-alpha-reductase 2; S5AR 2 Type II 5-alpha reductase; SRD5A2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-71aa; Partial
Sequence
KPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQ
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,393 Da
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 2
NCBI Official Synonym Full Names
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
NCBI Official Symbol
SRD5A2
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 2
UniProt Gene Name
SRD5A2
UniProt Synonym Gene Names
S5AR 2
UniProt Entry Name
S5A2_HUMAN

NCBI Description

This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq, Jul 2008]

Uniprot Description

SRD5A2: Converts testosterone (T) into 5-alpha- dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Defects in SRD5A2 are the cause of pseudovaginal perineoscrotal hypospadias (PPSH). A form of male pseudohermaphroditism in which 46,XY males show ambiguous genitalia at birth, including perineal hypospadias and a blind perineal pouch, and develop masculinization at puberty. The name of the disorder stems from the finding of a blind-ending perineal opening resembling a vagina and a severely hypospadiac penis with the urethra opening onto the perineum. Belongs to the steroid 5-alpha reductase family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Lipid Metabolism - androgen and estrogen; EC 1.3.1.22; Oxidoreductase

Chromosomal Location of Human Ortholog: 2p23

Cellular Component: endoplasmic reticulum membrane; cell soma; integral to membrane

Molecular Function: amide binding; cholestenone 5-alpha-reductase activity; sterol 5-alpha reductase activity; 3-oxo-5-alpha-steroid 4-dehydrogenase activity

Biological Process: steroid metabolic process; response to nutrient levels; response to drug; response to peptide hormone stimulus; hypothalamus development; dibenzo-p-dioxin metabolic process; male gonad development; phthalate metabolic process; androgen metabolic process; hippocampus development; response to testosterone stimulus; androgen biosynthetic process; female genitalia development; biphenyl metabolic process; cell-cell signaling; male genitalia development; cell differentiation; response to follicle-stimulating hormone stimulus; steroid catabolic process

Disease: Pseudovaginal Perineoscrotal Hypospadias

Research Articles on SRD5A2

Similar Products

Product Notes

The SRD5A2 srd5a2 (Catalog #AAA954548) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-71aa; Partial. The amino acid sequence is listed below: KPSGYGKHTE SLKPAATRLP ARAAWFLQEL PSFAVPAGIL ARQ. It is sometimes possible for the material contained within the vial of "3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.