Sortilin-related receptor (Sorl1) Recombinant Protein | Sorl1 recombinant protein
Recombinant Mouse Sortilin-related receptor (Sorl1) , partial
Gene Names
Sorl1; LR11; SorLA; gp250; mSorLA; AI596264; AW261561; 2900010L19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sortilin-related receptor (Sorl1); Recombinant Mouse Sortilin-related receptor (Sorl1); partial; Sorl1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
980-1196, Partial.
Sequence
QLSIFRASKHSRSQVEILASQLTGLMDMKVFYKGKNAGSNACVPQPCSLLCLPKANNSKSCRCPEGVASSVLPSGDLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTVCDADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEFNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIY
Sequence Length
1196
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sorl1 recombinant protein
This gene encodes a protein that belongs to the families of vacuolar protein sorting 10 (VPS10) domain-containing receptor proteins, of low density lipoprotein receptor (LDLR) proteins, and of fibronectin type III repeats proteins. In addition to VPS10, LDLR and fibronectin type 3 domains, this protein also includes an epidermal growth factor precursor-like module, a single transmembrane segment and a cytoplasmic tail with features similar to endocytosis- and sorting-competent receptors. Members of the VPS10 domain-containing receptor family are large with many exons but the CDS lengths are usually less than 3700 nt; this gene is an exception to the pattern with a CDS length greater than 6600 nt. Very large introns typically separate the exons encoding the VPS10 domain; the remaining exons are separated by much smaller-sized introns. The encoded protein is mainly intracellular and localizes in the paranuclear compartment. It is synthesized as a preproprotein, and when the propeptide is still attached, no binding occurs to the VPS10 domain. This gene is strongly expressed in the central nervous system.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
247,086 Da
NCBI Official Full Name
sortilin-related receptor isoform 1
NCBI Official Synonym Full Names
sortilin-related receptor, LDLR class A repeats-containing
NCBI Official Symbol
Sorl1
NCBI Official Synonym Symbols
LR11; SorLA; gp250; mSorLA; AI596264; AW261561; 2900010L19Rik
NCBI Protein Information
sortilin-related receptor
UniProt Protein Name
Sortilin-related receptor
Protein Family
UniProt Gene Name
Sorl1
UniProt Synonym Gene Names
LDLR relative with 11 ligand-binding repeats; LR11; mSorLA
Uniprot Description
Likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. Binds the receptor-associated protein (RAP). Could play a role in cell-cell interaction. May play a role in neural organization, as well as the establishment of embryonic organ systems. Involved in APP trafficking to and from the Golgi apparatus (). It probably acts as a sorting receptor that protects APP from trafficking to late endosome and from processing into amyloid beta (). Involved in the regulation of smooth muscle cells migration, probably through PLAUR binding and decreased internalization.
Research Articles on Sorl1
Similar Products
Product Notes
The Sorl1 sorl1 (Catalog #AAA1023711) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 980-1196, Partial. The amino acid sequence is listed below: QLSIFRASKH SRSQVEILAS QLTGLMDMKV FYKGKNAGSN ACVPQPCSLL CLPKANNSKS CRCPEGVASS VLPSGDLMCD CPQGYQRKNN TCVKEENTCL RNQYRCSNGN CINSIWWCDF DNDCGDMSDE RNCPTTVCDA DTQFRCQESG TCIPLSYKCD LEDDCGDNSD ESHCEMHQCR SDEFNCSSGM CIRSSWVCDG DNDCRDWSDE ANCTAIY . It is sometimes possible for the material contained within the vial of "Sortilin-related receptor (Sorl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
