Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Synaptosomal-associated protein 29 (Snap29) Recombinant Protein | Snap29 recombinant protein

Recombinant Mouse Synaptosomal-associated protein 29 (Snap29)

Gene Names
Snap29; Gs32; AI891940; AU020222; BB131856; 1300018G05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptosomal-associated protein 29 (Snap29); Recombinant Mouse Synaptosomal-associated protein 29 (Snap29); Snap29 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-260, full length protein
Sequence
MSGYPKSYNPFDDDVEEEDTRPAPWKDVRDLPDGPDAPIDRQQYLRQEVLRRAEATAASTSRSLSLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVSQPNSRLKEAINTSKDQENKYQASHPNLRRLQDAELDSVPKEPSSTVNTEVYPKNSTLRTYHQKIDSNLDELSVGLGHLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL
Sequence Length
260
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Snap29 recombinant protein
This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. This protein binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,572 Da
NCBI Official Full Name
synaptosomal-associated protein 29
NCBI Official Synonym Full Names
synaptosomal-associated protein 29
NCBI Official Symbol
Snap29
NCBI Official Synonym Symbols
Gs32; AI891940; AU020222; BB131856; 1300018G05Rik
NCBI Protein Information
synaptosomal-associated protein 29
UniProt Protein Name
Synaptosomal-associated protein 29
Protein Family
UniProt Gene Name
Snap29
UniProt Synonym Gene Names
Gs32

Uniprot Description

SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.

Research Articles on Snap29

Similar Products

Product Notes

The Snap29 snap29 (Catalog #AAA1462853) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-260, full length protein. The amino acid sequence is listed below: MSGYPKSYNP FDDDVEEEDT RPAPWKDVRD LPDGPDAPID RQQYLRQEVL RRAEATAAST SRSLSLMYES EKIGVASSEE LVRQRGVLEH TEKMVDKMDQ DLKMSQKHIN SIKSVFGGFI NYFKSKPVEP PPEQNGSIVS QPNSRLKEAI NTSKDQENKY QASHPNLRRL QDAELDSVPK EPSSTVNTEV YPKNSTLRTY HQKIDSNLDE LSVGLGHLKD IALGMQTEIE EQDDILDRLT TKVDKLDVNI KSTEKKVRQL. It is sometimes possible for the material contained within the vial of "Synaptosomal-associated protein 29 (Snap29), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.