Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (SLC35B3) Recombinant Protein | SLC35B3 recombinant protein

Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (SLC35B3), partial

Gene Names
SLC35B3; CGI-19; PAPST2; C6orf196
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (SLC35B3); Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (SLC35B3); partial; SLC35B3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
5-72. Partial
Sequence
QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,531 Da
NCBI Official Full Name
adenosine 3'-phospho 5'-phosphosulfate transporter 2
NCBI Official Synonym Full Names
solute carrier family 35 member B3
NCBI Official Symbol
SLC35B3
NCBI Official Synonym Symbols
CGI-19; PAPST2; C6orf196
NCBI Protein Information
adenosine 3'-phospho 5'-phosphosulfate transporter 2
UniProt Protein Name
Adenosine 3'-phospho 5'-phosphosulfate transporter 2
UniProt Gene Name
SLC35B3
UniProt Synonym Gene Names
C6orf196; PAPST2

NCBI Description

This gene is a member of the solute carrier family. The encoded protein is involved in the transport of 3-prime phosphoadenosine 5-prime phosphosulfate (PAPS) from the nucleus or the cytosol to the Golgi lumen. This gene has been reported to be expressed preferentially in the human colon tissues. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. Compensates for the insufficient expression of SLC35B2/PAPST1 during the synthesis of sulfated glycoconjugates in the colon.

Research Articles on SLC35B3

Similar Products

Product Notes

The SLC35B3 slc35b3 (Catalog #AAA7100236) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 5-72. Partial. The amino acid sequence is listed below: QQAKDIQNIT VQETNKNNSE SIECSKITMD LKFNNSRKYI SITVPSKTQT MSPHIKSVDD VVVLGMNL. It is sometimes possible for the material contained within the vial of "Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (SLC35B3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.