Pendrin (SLC26A4) Recombinant Protein | SLC26A4 recombinant protein
Recombinant Human Pendrin (SLC26A4), partial
Gene Names
SLC26A4; EVA; PDS; DFNB4; TDH2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pendrin (SLC26A4); Recombinant Human Pendrin (SLC26A4); partial; SLC26A4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
508-780. partial-length
Sequence
TVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,267 Da
NCBI Official Full Name
pendrin
NCBI Official Synonym Full Names
solute carrier family 26 member 4
NCBI Official Symbol
SLC26A4
NCBI Official Synonym Symbols
EVA; PDS; DFNB4; TDH2B
NCBI Protein Information
pendrin
UniProt Protein Name
Pendrin
Protein Family
UniProt Gene Name
SLC26A4
UniProt Synonym Gene Names
PDS
NCBI Description
Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq, Jul 2008]
Uniprot Description
Sodium-independent transporter of chloride and iodide.
Research Articles on SLC26A4
Similar Products
Product Notes
The SLC26A4 slc26a4 (Catalog #AAA1167311) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 508-780. partial-length. The amino acid sequence is listed below: TVVLRVQFPS WNGLGSIPST DIYKSTKNYK NIEEPQGVKI LRFSSPIFYG NVDGFKKCIK STVGFDAIRV YNKRLKALRK IQKLIKSGQL RATKNGIISD AVSTNNAFEP DEDIEDLEEL DIPTKEIEIQ VDWNSELPVK VNVPKVPIHS LVLDCGAISF LDVVGVRSLR VIVKEFQRID VNVYFASLQD YVIEKLEQCG FFDDNIRKDT FFLTVHDAIL YLQNQVKSQE GQGSILETIT LIQDCKDTLE LIETELTEEE LDVQDEAMRT LAS . It is sometimes possible for the material contained within the vial of "Pendrin (SLC26A4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
