Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitochondrial dicarboxylate carrier (Slc25a10) Recombinant Protein | Slc25a10 recombinant protein

Recombinant Mouse Mitochondrial dicarboxylate carrier (Slc25a10)

Gene Names
Slc25a10; Dic
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial dicarboxylate carrier (Slc25a10); Recombinant Mouse Mitochondrial dicarboxylate carrier (Slc25a10); Slc25a10 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-287aa; full length protein
Sequence
MAEARASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALY NGLSASLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPAD LVNVRMQNDMKLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSC YDQAKQLVLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCA METAKLGPQAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHFGIKVPTT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc25a10 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,715 Da
NCBI Official Full Name
mitochondrial dicarboxylate carrier
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier, dicarboxylate transporter), member 10
NCBI Official Symbol
Slc25a10
NCBI Official Synonym Symbols
Dic
NCBI Protein Information
mitochondrial dicarboxylate carrier
UniProt Protein Name
Mitochondrial dicarboxylate carrier
UniProt Gene Name
Slc25a10
UniProt Synonym Gene Names
Dic
UniProt Entry Name
DIC_MOUSE

Uniprot Description

SLC25A10: Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane. Belongs to the mitochondrial carrier family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Transporter, SLC family; Membrane protein, multi-pass; Mitochondrial; Membrane protein, integral

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrial membrane; mitochondrion; nucleus

Molecular Function: antiporter activity; malate transmembrane transporter activity; phosphate transmembrane transporter activity; secondary active transmembrane transporter activity; structural constituent of ribosome; succinate transmembrane transporter activity; sulfate transmembrane transporter activity; thiosulfate transmembrane transporter activity

Biological Process: malate transport; mitochondrial transport; phosphate transport; succinate transport; sulfate transport; thiosulfate transport; translation; transmembrane transport; transport

Research Articles on Slc25a10

Similar Products

Product Notes

The Slc25a10 slc25a10 (Catalog #AAA7029852) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-287aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc25a10 slc25a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEARASRWY FGGLASCGAA CCTHPLDLLK VHLQTQQEVK LRMTGMALQV VRTDGFLALY NGLSASLCRQ MTYSLTRFAI YETMRDYMTK DSQGPLPFYN KVLLGGISGL TGGFVGTPAD LVNVRMQNDM KLPPSQRRNY SHALDGLYRV AREESLRKLF SGATMASSRG ALVTVGQLSC YDQAKQLVLS TGYLSDNIFT HFVSSFIAGG CATFLCQPLD VLKTRLMNSK GEYQGVFHCA METAKLGPQA FFKGLFPAGI RLIPHTVLTF MFLEQLRKHF GIKVPTT. It is sometimes possible for the material contained within the vial of "Mitochondrial dicarboxylate carrier (Slc25a10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.