Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD352 recombinant protein

CD352 Recombinant Protein

Gene Names
SLAMF6; KALI; NTBA; CD352; KALIb; Ly108; NTB-A; SF2000
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD352; CD352 Recombinant Protein; CD352 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
627
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD352 recombinant protein
Background: SLAMF6 (CD352/NTB-A) is a type-I transmembrane glycoprotein belonging to the signaling lymphocytic activation molecule (SLAM) family of immunomodulatory receptors. Like other members of the SLAM receptor family, SLAMF6 contains Ig-like domains within its extracellular region and conserved tyrosine-based signaling motifs within its intracellular domain that, when phosphorylated, bind to the SAP and EAT-2 signaling adaptors. SLAMF6 is expressed on the surface of multiple types of immune cells, such as those of the B, T, and NK lineages. Its activation is triggered by homotypic interactions involving its extracellular domain. Indeed, research studies have shown that in T-cells, SLAMF6 engagement facilitates activation and cytokine production. Similarly, homotypic ligand-mediated engagement of SLAMF6 on NK cells activates signaling cascades that drive proliferation, cytotoxicity, and cytokine production.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,976 Da
NCBI Official Full Name
SLAM family member 6 isoform 1
NCBI Official Synonym Full Names
SLAM family member 6
NCBI Official Symbol
SLAMF6
NCBI Official Synonym Symbols
KALI; NTBA; CD352; KALIb; Ly108; NTB-A; SF2000
NCBI Protein Information
SLAM family member 6; NK-T-B-antigen; NTBA receptor; activating NK receptor; natural killer-, T- and B-cell antigen
UniProt Protein Name
SLAM family member 6
UniProt Gene Name
SLAMF6
UniProt Synonym Gene Names
KALI; NTB-A
UniProt Entry Name
SLAF6_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, May 2010]

Uniprot Description

SLAMF6: Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1q23.2

Cellular Component: integral to membrane; plasma membrane

Molecular Function: receptor activity

Research Articles on CD352

Similar Products

Product Notes

The CD352 slamf6 (Catalog #AAA3004286) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QSSLTPLMVN GILGESVTLP LEFPAGEKVN FITWLFNETS LAFIVPHETK SPEIHVTNPK QGKRLNFTQS YSLQLSNLKM EDTGSYRAQI STKTSAKLSS YTLRILRQLR NIQVTNHSQL FQNMTCELHL TCSVEDADDN VSFRWEALGN TLSSQPNLTV SWDPRISSEQ DYTCIAENAV SNLSFSVSAQ KLCEDVKIQY TDTKM. It is sometimes possible for the material contained within the vial of "CD352, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.