S-phase kinase-associated protein 1 (SKP1) Recombinant Protein | SKP1 recombinant protein

Recombinant Guinea pig S-phase kinase-associated protein 1 (SKP1)

Cat. Num. AAA953968

• Gene Names: Skp1; OCP2; p19A; Skp1a; ocp-2; OCP-II
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: S-phase kinase-associated protein 1 (SKP1); Recombinant Guinea pig S-phase kinase-associated protein 1 (SKP1); SKP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-163, Full length protein
• Sequence: PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
• Sequence Length: 162

• Species: Cavia porcellus (Guinea pig)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for SKP1 recombinant protein

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.

NCBI and Uniprot Product Information

• NCBI GI #: 290491216
• NCBI GeneID: 100135616
• NCBI Accession #: NP_001166486.1
• NCBI GenBank Nucleotide #: NM_001173015.1
• UniProt Accession #: P63209; P34991; Q8TAY2
• Molecular Weight: 18,658 Da
• NCBI Official Full Name: S-phase kinase-associated protein 1
• NCBI Official Symbol: Skp1
• NCBI Official Synonym Symbols: OCP2; p19A; Skp1a; ocp-2; OCP-II
• NCBI Protein Information: S-phase kinase-associated protein 1
• UniProt Protein Name: S-phase kinase-associated protein 1
• Protein Family: S-phase kinase-associated protein
• UniProt Gene Name: SKP1
• UniProt Synonym Gene Names: OCP2; SKP1A; OCP-2; OCP-II

Uniprot Description

Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) direct ubiquitination of TTI1 and TELO2. SCF(FBXO10) direct ubiquitination of BCL2.