Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Src kinase-associated phosphoprotein 1 (Skap1) Recombinant Protein | Skap1 recombinant protein

Recombinant Rat Src kinase-associated phosphoprotein 1 (Skap1)

Gene Names
Skap1; Scap1; Skap55
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Src kinase-associated phosphoprotein 1 (Skap1); Recombinant Rat Src kinase-associated phosphoprotein 1 (Skap1); Skap1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354, full length protein
Sequence
MQAIALPEEICWLLEDAEDFLAEGLQNENLSPGAQDQRDHILRGFQQIKSRYCWDFQPQGDDLGQDGSDENLSGTHGPALASDASFWSDYQEEGIDDIIRGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVISRGLFLYYANEKSKQPKGTFLIKGYNVRMAPHLRKDSKKDSCFELTSQDRRSYEFTAFSPAEARDWVDQISFLLKDLSSLTIPFEEEEEEEEEDKEQEEMYNDIDGFDSARSGSQGRAMALPEPLDKEEDVYEVLPDEDDLEEDACGAHRRRVDYADYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSIIGIVPKDYLTTAFEMEGR
Sequence Length
354
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Skap1 recombinant protein
This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,903 Da
NCBI Official Full Name
src kinase-associated phosphoprotein 1
NCBI Official Synonym Full Names
src kinase associated phosphoprotein 1
NCBI Official Symbol
Skap1
NCBI Official Synonym Symbols
Scap1; Skap55
NCBI Protein Information
src kinase-associated phosphoprotein 1
UniProt Protein Name
Src kinase-associated phosphoprotein 1
UniProt Gene Name
Skap1
UniProt Synonym Gene Names
Scap1; Skap55; SKAP-55

NCBI Description

cytoplasmic phosphoprotein; member of the src family of kinase enzymes; may associate with mast cell immunoreceptor signal transducer (MIST) [RGD, Feb 2006]

Uniprot Description

Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells (). May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells.

Similar Products

Product Notes

The Skap1 skap1 (Catalog #AAA1444254) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354, full length protein. The amino acid sequence is listed below: MQAIALPEEI CWLLEDAEDF LAEGLQNENL SPGAQDQRDH ILRGFQQIKS RYCWDFQPQG DDLGQDGSDE NLSGTHGPAL ASDASFWSDY QEEGIDDIIR GAQELDNVIK QGYLEKKSKD HSFFGSEWQK RWCVISRGLF LYYANEKSKQ PKGTFLIKGY NVRMAPHLRK DSKKDSCFEL TSQDRRSYEF TAFSPAEARD WVDQISFLLK DLSSLTIPFE EEEEEEEEDK EQEEMYNDID GFDSARSGSQ GRAMALPEPL DKEEDVYEVL PDEDDLEEDA CGAHRRRVDY ADYYQGLWDC HGDQPDELSF QRGDLIRILS KEYNMYGWWV GELNSIIGIV PKDYLTTAFE MEGR. It is sometimes possible for the material contained within the vial of "Src kinase-associated phosphoprotein 1 (Skap1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.