Protein Z-dependent protease inhibitor (Serpina10) Recombinant Protein | Serpina10 recombinant protein
Recombinant Mouse Protein Z-dependent protease inhibitor (Serpina10)
Gene Names
Serpina10; PZI; ZPI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Z-dependent protease inhibitor (Serpina10); Recombinant Mouse Protein Z-dependent protease inhibitor (Serpina10); Serpina10 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-448, full length protein
Sequence
FNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEEYWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQAGPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLINHCIVKETEGKIPKLFDEINPETKLILVDYVLFKGKWLTPFDPSFTEADTFHLDKYRAIKVPMMYREGNFTSTFDKKFRCHILKLPYQGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKTRKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSGTLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL
Sequence Length
427
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,298 Da
NCBI Official Full Name
protein Z-dependent protease inhibitor isoform 2
NCBI Official Synonym Full Names
serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
NCBI Official Symbol
Serpina10
NCBI Official Synonym Symbols
PZI; ZPI
NCBI Protein Information
protein Z-dependent protease inhibitor
UniProt Protein Name
Protein Z-dependent protease inhibitor
Protein Family
UniProt Gene Name
Serpina10
UniProt Synonym Gene Names
Zpi; PZ-dependent protease inhibitor; PZI
NCBI Description
The protein encoded by this gene is a member of the large serpin family of proteins, and is also known as serpin PZ-dependent protease inhibitor (ZPI or PZI). This protein is thought to play an important role in the regulation of coagulation. It directly inhibits factor XIa, and also inhibits factor Xa in the presence of calcium, phospholipids, and protein Z (PZ). Deficiencies in this gene lead to an increase in thrombosis. Alternative splicing results in multiple transcript variants that encode multiple protein isoforms. [provided by RefSeq, Aug 2014]
Uniprot Description
Inhibits activity of the coagulation protease factor Xa in the presence of PROZ, calcium and phospholipids. Also inhibits factor XIa in the absence of cofactors ().
Research Articles on Serpina10
Similar Products
Product Notes
The Serpina10 serpina10 (Catalog #AAA1378263) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-448, full length protein. The amino acid sequence is listed below: FNLSSHSPEA SVHLESQDYE NQTWEEYTRT DPREEEEEEE EKEEGKDEEY WLRASQQLSN ETSSFGFNLL RKISMRHDGN VIFSPFGLSV AMVNLMLGTK GETKVQIENG LNLQALSQAG PLILPALFKK VKETFSSNRD LGLSQGSFAF IHKDFDIKET YFNLSKKYFD IEYVSINFQN SSQARGLINH CIVKETEGKI PKLFDEINPE TKLILVDYVL FKGKWLTPFD PSFTEADTFH LDKYRAIKVP MMYREGNFTS TFDKKFRCHI LKLPYQGNAT MLVVLMEKTG DYLALEDYLT VDLVETWLQN MKTRKMEVFF PKFKLNQRYE MHELLKQMGI RRLFSTSADL SELSAMARNL QVSRVLQQSV LEVDERGTEA VSGTLSEIIA YSMPPAIKVN RPFHFIIYEE MSRMLLFLGR VVNPTVL. It is sometimes possible for the material contained within the vial of "Protein Z-dependent protease inhibitor (Serpina10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
