Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sequence Information (The original sequence contains 12 'U's (yellow highlights) UniProt (reference:: (P49907) that have been mutated to 'S' in the sequence for manufacturing the MBS964014 Bovine Selenoprotein P recombinant protein. The 'U' selenocysteine is encoded by UGA and is typically used as a stop codon in prokaryotic cells, which will lead to early termination of translation. Hence, the lab mutates the selenocysteine which is a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. The selenocysteine can be regarded as either the 'S' atom of cysteine replaced by Se (selenium atom) , or the 'O' atom of serine replaced by Se (selenium atom). Selenocysteine can mutated to either serine or cysteine. The lab has mutated selenocysteine 'U' to serine for protein expression because mutating 'U' to cysteine can lead to the formation of additional disulfide bonds, which can affect the expression and structure of the recombinant protein)

Selenoprotein P (SEPP1) Recombinant Protein | SEPP1 recombinant protein

Recombinant Bovine Selenoprotein P (SEPP1)

Gene Names
SEPP1; SELP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Selenoprotein P (SEPP1); Recombinant Bovine Selenoprotein P (SEPP1); Selenoprotein P; SeP; Selenoprotein P-like protein; SEPP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-402aa; Full Length of Mature Protein
Sequence
ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN (The original sequence contains 12 'U's (P49907: U59S, U297S, U307S, U338S, U350S, U363S, U365S, U372S, U388S, U390S, U397S, U399S) that have already been replaced with 'S' (serine) in the sequence. The 'U' selenocysteine is encoded by UGA and is typically used as a stop codon in prokaryotic cells.)
Sequence Positions
20-402. Full Length of Mature Protein. The original sequence contains 12 'U's (P49907) that have already been replaced with 'S' (serine) in the sequence. The 'U' selenocysteine is encoded by UGA and is typically used as a stop codon in prokaryotic cells, which will lead to early termination of translation. Hence, 'U's have mutated with 'S' for protein manufacture.
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Sequence Information

(The original sequence contains 12 'U's (yellow highlights) UniProt (reference:: (P49907) that have been mutated to 'S' in the sequence for manufacturing the MBS964014 Bovine Selenoprotein P recombinant protein. The 'U' selenocysteine is encoded by UGA and is typically used as a stop codon in prokaryotic cells, which will lead to early termination of translation. Hence, the lab mutates the selenocysteine which is a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. The selenocysteine can be regarded as either the 'S' atom of cysteine replaced by Se (selenium atom) , or the 'O' atom of serine replaced by Se (selenium atom). Selenocysteine can mutated to either serine or cysteine. The lab has mutated selenocysteine 'U' to serine for protein expression because mutating 'U' to cysteine can lead to the formation of additional disulfide bonds, which can affect the expression and structure of the recombinant protein)

Sequence Information (The original sequence contains 12 'U's (yellow highlights) UniProt (reference:: (P49907) that have been mutated to 'S' in the sequence for manufacturing the MBS964014 Bovine Selenoprotein P recombinant protein. The 'U' selenocysteine is encoded by UGA and is typically used as a stop codon in prokaryotic cells, which will lead to early termination of translation. Hence, the lab mutates the selenocysteine which is a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. The selenocysteine can be regarded as either the 'S' atom of cysteine replaced by Se (selenium atom) , or the 'O' atom of serine replaced by Se (selenium atom). Selenocysteine can mutated to either serine or cysteine. The lab has mutated selenocysteine 'U' to serine for protein expression because mutating 'U' to cysteine can lead to the formation of additional disulfide bonds, which can affect the expression and structure of the recombinant protein)

SDS-PAGE

SDS-PAGE
Related Product Information for SEPP1 recombinant protein
Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70.1 kDa
NCBI Official Full Name
selenoprotein P
NCBI Official Symbol
SEPP1
NCBI Official Synonym Symbols
SELP
NCBI Protein Information
selenoprotein P; seP; selenoprotein P-like protein
UniProt Protein Name
Selenoprotein P
Protein Family
UniProt Gene Name
SEPP1
UniProt Synonym Gene Names
SELP; SeP
UniProt Entry Name
SEPP1_BOVIN

NCBI Description

This gene encodes a selenoprotein that is predominantly expressed in the liver and secreted into the plasma. This selenoprotein is unique in that it contains multiple selenocysteine (Sec) residues per polypeptide (12 in cow), and accounts for most of the selenium in plasma. It has been implicated as an extracellular antioxidant, and in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2). Mice lacking this gene exhibit neurological dysfunction, suggesting its importance in normal brain function. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. The mRNA for this selenoprotein contains two SECIS elements. [provided by RefSeq, Feb 2017]

Uniprot Description

Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

Similar Products

Product Notes

The SEPP1 sepp1 (Catalog #AAA964014) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-402aa; Full Length of Mature Protein. The amino acid sequence is listed below: ESQGQSSYCK QPPPWSIKDQ DPMLNSYGSV TVVALLQASS YLCILQASRL EDLRVKLEKE GYSNISYVVV NHQGISSRLK YVHLKNKVSE HIPVYQQEEN QPDVWTLLNG NKDDFLIYDR CGRLVYHLGL PYSFLTFTYV EDSIKTVYCE DKCGNCSLKA LEDEDVCKNV FLATKEKTAE ASQRHHHPHP HSHPHPHPHP HPHPHPHPHH GHQLHENAHL SESPKPDTPD TPENPPPSGL HHHHHRHKGP QRQGHSDNCD TPVGSESLQP SLPQKKLSRK RCINQLLSQF PKDSESALSS CCCHCRHLVF EKTGSAITSQ CTEKLPSLCS SQGLLAEENV IESSQSRLPP AASQAAGQQL NPTEASTKSS SKNKAKMSKS PSN (The original sequence contains 12 'U's (P49907: U59S, U297S, U307S, U338S, U350S, U363S, U365S, U372S, U388S, U390S, U397S, U399S) that have already been replaced with 'S' (serine) in the sequence. The 'U' selenocyst eine is encoded by UGA and is typically used as a stop codon in prokaryoti c cells.). It is sometimes possible for the material contained within the vial of "Selenoprotein P (SEPP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.