Diamine acetyltransferase 1 Recombinant Protein | SAT1 recombinant protein

Recombinant Human Diamine acetyltransferase 1

Cat. Num. AAA1265353

• Gene Names: SAT1; SAT; DC21; KFSD; SSAT; KFSDX; SSAT-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Diamine acetyltransferase 1; Recombinant Human Diamine acetyltransferase 1; Polyamine N-acetyltransferase 1; Putrescine acetyltransferase; Spermidine/spermine N(1)-acetyltransferase 1; SSAT; SSAT-1; SAT1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 5-171aa; Full Length
• Sequence: VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
• Sequence Length: 171

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SAT1 recombinant protein

Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.

Product Categories/Family for SAT1 recombinant protein

Metabolism

References

Isolation and characterization of a cDNA clone that codes for human spermidine/spermine N1-acetyltransferase.Casero R.A. Jr., Celano P., Ervin S.J., Applegren N.B., Wiest L., Pegg A.E.J. Biol. Chem. 266:810-814(1991)

NCBI and Uniprot Product Information

• NCBI GI #: 4506789
• NCBI GeneID: 6303
• NCBI Accession #: NP_002961.1
• NCBI GenBank Nucleotide #: NM_002970.3
• UniProt Accession #: P21673
• Molecular Weight: 23.5 kDa
• NCBI Official Full Name: diamine acetyltransferase 1
• NCBI Official Synonym Full Names: spermidine/spermine N1-acetyltransferase 1
• NCBI Official Symbol: SAT1
• NCBI Official Synonym Symbols: SAT; DC21; KFSD; SSAT; KFSDX; SSAT-1
• NCBI Protein Information: diamine acetyltransferase 1
• UniProt Protein Name: Diamine acetyltransferase 1
• Protein Family: Diamine acetyltransferase
• UniProt Gene Name: SAT1
• UniProt Synonym Gene Names: SAT; SSAT; SSAT-1
• UniProt Entry Name: SAT1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the acetyltransferase family, and is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the acetylation of spermidine and spermine, and is involved in the regulation of the intracellular concentration of polyamines and their transport out of cells. Defects in this gene are associated with keratosis follicularis spinulosa decalvans (KFSD). Alternatively spliced transcripts have been found for this gene.[provided by RefSeq, Sep 2009]

Uniprot Description

SAT: Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine. Defects in SAT1 may be a cause of keratosis follicularis spinulosa decalvans X-linked (KFSDX). A rare disorder affecting the skin and the eye. Affected men show thickening of the skin of the neck, ears, and extremities, especially the palms and soles, loss of eyebrows, eyelashes and beard, thickening of the eyelids with blepharitis and ectropion, and corneal degeneration. Belongs to the acetyltransferase family.

Protein type: Acetyltransferase; EC 2.3.1.57; Amino Acid Metabolism - arginine and proline

Chromosomal Location of Human Ortholog: Xp22.1

Cellular Component: cytosol; intracellular

Molecular Function: diamine N-acetyltransferase activity; protein binding

Biological Process: angiogenesis; polyamine biosynthetic process; polyamine metabolic process; putrescine catabolic process; regulation of cell proliferation

Disease: Keratosis Follicularis Spinulosa Decalvans, X-linked