Holliday junction ATP-dependent DNA helicase RuvB Recombinant Protein | ruvB recombinant protein

Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvB

Cat. Num. AAA1261792

• Gene Names: ruvB; ECK1861; JW1849
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Holliday junction ATP-dependent DNA helicase RuvB; Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvB; ruvB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-336aa; Full Length
• Sequence: MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP
• Sequence Length: 336

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ruvB recombinant protein

The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing.

References

Nucleotide sequencing of the ruv region of Escherichia coli K-12 reveals a LexA regulated operon encoding two genes.Benson F.E., Illing G.T., Sharples G.J., Lloyd R.G.Nucleic Acids Res. 16:1541-1549(1988) Structure and regulation of the Escherichia coli ruv operon involved in DNA repair and recombination.Shinagawa H., Makino K., Amemura M., Kimura S., Iwasaki H., Nakata A.J. Bacteriol. 170:4322-4329(1988) A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) RuvA and RuvB proteins of Escherichia coli exhibit DNA helicase activity in vitro.Tsaneva I.R., Mueller B., West S.C.Proc. Natl. Acad. Sci. U.S.A. 90:1315-1319(1993) A dual function of the CRISPR-Cas system in bacterial antivirus immunity and DNA repair.Babu M., Beloglazova N., Flick R., Graham C., Skarina T., Nocek B., Gagarinova A., Pogoutse O., Brown G., Binkowski A., Phanse S., Joachimiak A., Koonin E.V., Savchenko A., Emili A., Greenblatt J., Edwards A.M., Yakunin A.F.Mol. Microbiol. 79:484-502(2011) Processing of recombination intermediates by the RuvABC proteins.West S.C.Annu. Rev. Genet. 31:213-244(1997)

NCBI and Uniprot Product Information

• NCBI GeneID: 946371
• UniProt Accession #: P0A812; P08577
• Molecular Weight: 53.2 kDa
• NCBI Official Symbol: ruvB
• NCBI Official Synonym Symbols: ECK1861; JW1849
• NCBI Protein Information: ATP-dependent DNA helicase, component of RuvABC resolvasome
• UniProt Protein Name: Holliday junction ATP-dependent DNA helicase RuvB
• Protein Family: Holliday junction DNA helicase
• UniProt Gene Name: ruvB
• UniProt Entry Name: RUVB_ECOLI

NCBI Description

May directly convert replication forks into Holliday junctions. [More information is available at EcoGene: EG10924]. RuvABC is an enzymatic complex which functions in recombination pathways by binding to recombinational junctions and catalyzing strand cleavage and branch migration. [More information is available at EcoCyc: RUVB].

Uniprot Description

The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing.