Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

ATP synthase subunit delta, mitochondrial (ATP5D) Recombinant Protein | ATP5D recombinant protein

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit delta; mitochondrial (ATP5D); Recombinant Human ATP synthase subunit delta; F-ATPase delta subunit; ATP5D recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-168. Full Length of Mature Protein
Sequence
AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for ATP5D recombinant protein
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F1 domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Product Categories/Family for ATP5D recombinant protein
References
Molecular cloning of an import precursor of the delta-subunit of the human mitochondrial ATP synthase complex.Jordan E.M., Breen G.A.M.Biochim. Biophys. Acta 1130:123-126(1992)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
513
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
ATP synthase subunit delta, mitochondrial
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
NCBI Official Symbol
ATP5D
NCBI Protein Information
ATP synthase subunit delta, mitochondrial
UniProt Protein Name
ATP synthase subunit delta, mitochondrial
UniProt Gene Name
ATP5D
UniProt Entry Name
ATPD_HUMAN

NCBI Description

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP5D: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Belongs to the ATPase epsilon chain family.

Protein type: EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation; Mitochondrial; Hydrolase

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: mitochondrial inner membrane; mitochondrial matrix; mitochondrial proton-transporting ATP synthase complex; mitochondrion

Molecular Function: ADP binding; ATP binding; ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; hydrogen ion transporting ATPase activity, rotational mechanism; transmembrane transporter activity; transporter activity

Biological Process: ATP biosynthetic process; ATP synthesis coupled proton transport; cellular metabolic process; mitochondrial ATP synthesis coupled proton transport; oxidative phosphorylation; response to copper ion

Similar Products

Product Notes

The ATP5D atp5d (Catalog #AAA948063) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-168. Full Length of Mature Protein. The amino acid sequence is listed below: AEAAAAPAAA SGPNQMSFTF ASPTQVFFNG ANVRQVDVPT LTGAFGILAA HVPTLQVLRP GLVVVHAEDG TTSKYFVSSG SIAVNADSSV QLLAEEAVTL DMLDLGAAKA NLEKAQAELV GTADEATRAE IQIRIEANEA LVKALE . It is sometimes possible for the material contained within the vial of "ATP synthase subunit delta, mitochondrial (ATP5D), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.