SDS-Page
DNA repair protein RecO Recombinant Protein | recO recombinant protein
Recombinant Escherichia coli DNA repair protein RecO
Gene Names
recO; ECK2563; JW2549
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA repair protein RecO; Recombinant Escherichia coli DNA repair protein RecO; Recombination protein O; recO recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-242aa; Full Length
Sequence
MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE
Sequence Length
242
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for recO recombinant protein
Involved in DNA repair and RecF pathway recombination.
References
Genetic analysis of the rnc operon of Escherichia coli.Takiff H.E., Chen S.M., Court D.L.J. Bacteriol. 171:2581-2590(1989)
Molecular analysis of the Escherichia coli recO gene.Morrison P.T., Lovett S.T., Gilson L.E., Kolodner R.J. Bacteriol. 171:3641-3649(1989)
Nashimoto H., Saito N. The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Purification and characterization of the Escherichia coli RecO protein. Renaturation of complementary single-stranded DNA molecules catalyzed by the RecO protein.Luisi-DeLuca C., Kolodner R.J. Mol. Biol. 236:124-138(1994)
Suppression of insertions in the complex pdxJ operon of Escherichia coli K-12 by lon and other mutations.Lam H.-M., Tancula E., Dempsey W.B., Winkler M.E.J. Bacteriol. 174:1554-1567(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43.4 kDa
NCBI Official Full Name
gap repair protein
NCBI Official Symbol
recO
NCBI Official Synonym Symbols
ECK2563; JW2549
NCBI Protein Information
gap repair protein
UniProt Protein Name
DNA repair protein RecO
Protein Family
UniProt Gene Name
recO
UniProt Entry Name
RECO_ECOLI
NCBI Description
In Escherichia coli replication is temporarily inhibited after DNA damage, such as caused by UV, but resumes following a period of time commensurate with the removal of the lesions . [More information is available at EcoCyc: EG10832].
Uniprot Description
Involved in DNA repair and RecF pathway recombination.
Research Articles on recO
Similar Products
Product Notes
The recO reco (Catalog #AAA1195999) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-242aa; Full Length. The amino acid sequence is listed below: MEGWQRAFVL HSRPWSETSL MLDVFTEESG RVRLVAKGAR SKRSTLKGAL QPFTPLLLRF GGRGEVKTLR SAEAVSLALP LSGITLYSGL YINELLSRVL EYETRFSELF FDYLHCIQSL AGVTGTPEPA LRRFELALLG HLGYGVNFTH CAGSGEPVDD TMTYRYREEK GFIASVVIDN KTFTGRQLKA LNAREFPDAD TLRAAKRFTR MALKPYLGGK PLKSRELFRQ FMPKRTVKTH YE. It is sometimes possible for the material contained within the vial of "DNA repair protein RecO, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
