Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein CBFA2T1 (Runx1t1) Recombinant Protein | Runx1t1 recombinant protein

Recombinant Mouse Protein CBFA2T1 (Runx1t1)

Gene Names
Runx1t1; ETO; MTG8; Cbfa2t1h
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein CBFA2T1 (Runx1t1); Recombinant Mouse Protein CBFA2T1 (Runx1t1); Runx1t1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-577, Full length protein
Sequence
MPDRTEKHSTMPDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGSSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAPQQGDTPAVSSSVTPSSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
Sequence Length
577
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Runx1t1 recombinant protein
This protein is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5 -region of the RUNX1 gene fused to the 3 -region of this gene. The chimeric protein is thought to associate with the nuclear corepressor
histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,338 Da
NCBI Official Full Name
protein CBFA2T1 isoform 3
NCBI Official Synonym Full Names
runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
NCBI Official Symbol
Runx1t1
NCBI Official Synonym Symbols
ETO; MTG8; Cbfa2t1h
NCBI Protein Information
protein CBFA2T1
UniProt Protein Name
Protein CBFA2T1
Protein Family
UniProt Gene Name
Runx1t1
UniProt Synonym Gene Names
Cbfa2t1; Cbfa2t1h; Mtg8

Uniprot Description

Transcriptional corepressor which facilitates transcriptional repression via its association with DNA-binding transcription factors and recruitment of other corepressors and histone-modifying enzymes. Can repress the expression of MMP7 in a ZBTB33-dependent manner. Can repress transactivation mediated by TCF12 (). Acts as a negative regulator of adipogenesis (PubMed:23527555).

Research Articles on Runx1t1

Similar Products

Product Notes

The Runx1t1 runx1t1 (Catalog #AAA1440240) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-577, Full length protein. The amino acid sequence is listed below: MPDRTEKHST MPDSPVDVKT QSRLTPPAMP PPPTTQGAPR TSSFTPTTLT NGTSHSPTAL NGAPSPPNGF SNGPSSSSSS SLANQQLPPA CGARQLSKLK RFLTTLQQFG NDISPEIGER VRTLVLGLVN STLTIEEFHS KLQEATNFPL RPFVIPFLKA NLPLLQRELL HCARLAKQNP AQYLAQHEQL LLDASTTSPV DSSELLLDVN ENGKRRTPDR TKENGFDREP LHSEHPSKRP CTISPGQRYS PNNGLSYQPN GLPHPTPPPP QHYRLDDMAI AHHYRDSYRH PSHRDLRDRN RPMGLHGTRQ EEMIDHRLTD REWAEEWKHL DHLLNCIMDM VEKTRRSLTV LRRCQEADRE ELNYWIRRYS DAEDLKKGGS SSSSHSRQQS PVNPDPVALD AHREFLHRPA SGYVPEEIWK KAEEAVNEVK RQAMTELQKA VSEAERKAHD MITTERAKME RTVAEAKRQA AEDALAVINQ QEDSSESCWN CGRKASETCS GCNTARYCGS FCQHKDWEKH HHICGQTLQA PQQGDTPAVS SSVTPSSGAG SPMDTPPAAT PRSTTPGTPS TIETTPR. It is sometimes possible for the material contained within the vial of "Protein CBFA2T1 (Runx1t1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.