Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlRUNX1T1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit RUNX1T1 Polyclonal Antibody | anti-RUNX1T1 antibody

RUNX1T1 antibody - middle region

Gene Names
RUNX1T1; CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
RUNX1T1; Polyclonal Antibody; RUNX1T1 antibody - middle region; anti-RUNX1T1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAI
Sequence Length
604
Applicable Applications for anti-RUNX1T1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RUNX1T1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlRUNX1T1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlRUNX1T1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-RUNX1T1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that RUNX1T1 is expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-RUNX1T1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that RUNX1T1 is expressed in HepG2)
Related Product Information for anti-RUNX1T1 antibody
This is a rabbit polyclonal antibody against RUNX1T1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RUNX1T1 is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
862
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
protein CBFA2T1 isoform C
NCBI Official Synonym Full Names
RUNX1 translocation partner 1
NCBI Official Symbol
RUNX1T1
NCBI Official Synonym Symbols
CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
NCBI Protein Information
protein CBFA2T1
UniProt Protein Name
Protein CBFA2T1
Protein Family
UniProt Gene Name
RUNX1T1
UniProt Synonym Gene Names
AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2
UniProt Entry Name
MTG8_HUMAN

NCBI Description

This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Uniprot Description

RUNX1T1: Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12. Homotetramer. Heterotetramer with CBFA2T2 and CBFA2T3. Interacts with TCF12, SIN3A, HDAC1, HDAC2, HDAC3, NCOR1 and NCOR2. Interacts with ATN1 (via its N-terminus); the interaction enhances the transcriptional repression. Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary. Belongs to the CBFA2T family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation; Oncoprotein

Chromosomal Location of Human Ortholog: 8q22

Cellular Component: nucleoplasm; nuclear matrix; mitochondrion; cytoplasm

Molecular Function: identical protein binding; protein binding; DNA binding; metal ion binding; transcription factor activity; transcription corepressor activity

Biological Process: generation of precursor metabolites and energy; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent

Research Articles on RUNX1T1

Similar Products

Product Notes

The RUNX1T1 runx1t1 (Catalog #AAA3201819) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUNX1T1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX1T1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RUNX1T1 runx1t1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LHSEHPSKRP CTISPGQRYS PNNGLSYQPN GLPHPTPPPP QHYRLDDMAI. It is sometimes possible for the material contained within the vial of "RUNX1T1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.