Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Recombinant Protein | RELA recombinant protein

Recombinant V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA)

Gene Names
Rela; p65
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA); Recombinant V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA); RELA recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-GPY VEIIEQPKQR GMRFRYKCEG RSAGSIPGER STDTTKTHPT IKINGYTGPG TVRISLVTKD PPHRPHPHEL VGKDCRDGYY EADLCPDRSI HSFQNLGIQC VKKRDLEQAI SQRIQTNNNP FHVPIEEQRG DYDLNAVRLC FQVTVRDPAG RPLLLTPVLS HPIFDNRAPN TAELKICRVN RNSGSCLGGD EIFLLCDKVQ KEDIEVYFTG PGWEARGSFS QADVHRQVAI VFRTPPYADP SLQAPVRVSM QLRRPSDREL SEPMEFQYLP DTDDRHRIEE KRKRTY
Sequence Length
549
Applicable Applications for RELA recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Mus musculus (Mouse)
Expression System
Prokaryotic expression
Residues
Gly18~Tyr306 (Accession # Q04207) with two N-terminal Tags, His-tag and T7-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.8kDa
NCBI Official Full Name
transcription factor p65
NCBI Official Synonym Full Names
v-rel reticuloendotheliosis viral oncogene homolog A (avian)
NCBI Official Symbol
Rela
NCBI Official Synonym Symbols
p65
NCBI Protein Information
transcription factor p65; p65 NFkB; p65 NF kappaB; p65 NF-kappa B; nuclear factor NF-kappa-B p65 subunit; avian reticuloendotheliosis viral (v-rel) oncogene homolog A; nuclear factor of kappa light polypeptide gene enhancer in B-cells 3
UniProt Protein Name
Transcription factor p65
Protein Family
UniProt Gene Name
Rela
UniProt Synonym Gene Names
Nfkb3
UniProt Entry Name
TF65_MOUSE

Uniprot Description

NFkB-p65: a subunit of NF-kappa-B transcription complex, which plays a crucial role in inflammatory and immune responses. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. P65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. Three splice-variant isoforms have been identified.

Protein type: Nuclear receptor co-regulator; Transcription factor; DNA-binding

Cellular Component: nucleoplasm; transcription factor complex; protein complex; cytoplasm; nucleus; cytosol

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; identical protein binding; transcription activator binding; protein N-terminus binding; protein kinase binding; transcription factor binding; NF-kappaB binding; protein binding; enzyme binding; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; ubiquitin protein ligase binding; protein complex binding; chromatin binding; phosphate binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; cellular response to stress; positive regulation of transcription, DNA-dependent; negative regulation of insulin receptor signaling pathway; defense response; negative regulation of transcription from RNA polymerase II promoter; activation of NF-kappaB transcription factor; response to organic substance; hair follicle development; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; inflammatory response; positive regulation of Schwann cell differentiation; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; liver development; response to UV-B; regulation of transcription from RNA polymerase II promoter; organ morphogenesis; positive regulation of interleukin-12 biosynthetic process; positive regulation of chondrocyte differentiation; response to bacterium; response to muramyl dipeptide; response to cytokine stimulus; regulation of inflammatory response; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein catabolic process; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis

Research Articles on RELA

Similar Products

Product Notes

The RELA rela (Catalog #AAA2009764) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the RELA rela for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-GPY VEIIEQPKQR GMRFRYKCEG RSAGSIPGER STDTTKTHPT IKINGYTGPG TVRISLVTKD PPHRPHPHEL VGKDCRDGYY EADLCPDRSI HSFQNLGIQC VKKRDLEQAI SQRIQTNNNP FHVPIEEQRG DYDLNAVRLC FQVTVRDPAG RPLLLTPVLS HPIFDNRAPN TAELKICRVN RNSGSCLGGD EIFLLCDKVQ KEDIEVYFTG PGWEARGSFS QADVHRQVAI VFRTPPYADP SLQAPVRVSM QLRRPSDREL SEPMEFQYLP DTDDRHRIEE KRKRTY. It is sometimes possible for the material contained within the vial of "V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.