RNA-binding motif protein, X chromosome (rbmx) Recombinant Protein | rbmx recombinant protein

Recombinant Danio rerio RNA-binding motif protein, X chromosome (rbmx)

Cat. Num. AAA1316539

• Gene Names: rbmx; fc66e11; hnRNP G; wu:fb37c07; wu:fc66e11
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: RNA-binding motif protein; X chromosome (rbmx); Recombinant Danio rerio RNA-binding motif protein; rbmx recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-379, Full length protein
• Sequence: MAEADRPGKLFIGGLNTETSEKVLEAYFSKFGRISEVLLMKDRETNKSRGFAFVTYENPGDAKDAAREMNGKPLDGKPIKVEQATKPQFETSGRRGPPPPRSRGPSRGLRGSRGGPSGMRGPPSREPFFKGMSSRGPPPMKRGPPERNGGPPPKRSAPSGPMGRPSRDRDPYGPPPRRDSLMSRRDDGPPHRDDHYGSKDSYSSRDYMSSRDSRDYGPPPRDYPYREYSGHSSSRDDYGSGSRGYSDRDGYGGGREPRGYIDRPSAGSYRDPYDGYGNSRSAPPSRGPPPSYSGSGGSSRYDDYGSSSRDGYGSRDSYPSSRSDPYSTNRGDRPGRQERGPPPLERGYPREYSSSSRGAPRGGGRGGRRPDRGMGRNRY
• Sequence Length: 379

• Species: Zebrafish
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 47086837
• NCBI GeneID: 321860
• NCBI Accession #: NP_997763.1
• NCBI GenBank Nucleotide #: NM_212598.1
• UniProt Accession #: Q7ZWA3; Q6TLG7
• Molecular Weight: 30,606 Da
• NCBI Official Full Name: RNA-binding motif protein, X chromosome
• NCBI Official Synonym Full Names: RNA binding motif protein, X-linked
• NCBI Official Symbol: rbmx
• NCBI Official Synonym Symbols: fc66e11; hnRNP G; wu:fb37c07; wu:fc66e11
• NCBI Protein Information: RNA-binding motif protein, X chromosome
• UniProt Protein Name: RNA-binding motif protein, X chromosome
• Protein Family: RNA-binding motif protein
• UniProt Gene Name: rbmx
• UniProt Synonym Gene Names: hnRNP G

Uniprot Description

RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of pre-mRNAs. Associates with chromatin. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Binds non-specifically to pre-mRNAs (). Required for embryonic development, in particular of the brain.