Usp10 blocking peptide
Usp10 Peptide - C-terminal region
Reactivity
Rat
Applications
Western Blot
Synonyms
Usp10; Usp10 Peptide - C-terminal region; Usp10 blocking peptide
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
RDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEML
Sequence Length
794
Applicable Applications for Usp10 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Usp10 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Usp10 Antibody, made
Target Description: Usp10 is a hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, SNX3 and CFTR. It acts as an essential regulator of p53/TP53 stability: in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Usp10 does not deubiquitinate MDM2 and deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling.
Target Description: Usp10 is a hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, SNX3 and CFTR. It acts as an essential regulator of p53/TP53 stability: in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Usp10 does not deubiquitinate MDM2 and deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling.
Product Categories/Family for Usp10 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 10
NCBI Official Synonym Full Names
ubiquitin specific peptidase 10
NCBI Official Symbol
Usp10
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 10
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 10
UniProt Gene Name
Usp10
UniProt Entry Name
UBP10_RAT
Similar Products
Product Notes
The Usp10 usp10 (Catalog #AAA3239215) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Usp10 Peptide - C-terminal region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Usp10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Usp10 usp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RDIRPGAAFE PTYIYRLLTV IKSSLSEKGR QEDAEEYLGF ILNGLHEEML. It is sometimes possible for the material contained within the vial of "Usp10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
