CDK4 blocking peptide
CDK4 Peptide - middle region
Reactivity
Rat
Synonyms
CDK4; CDK4 Peptide - middle region; CDK4 blocking peptide
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDF
Sequence Length
303
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CDK4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CDK4 Antibody, made
Target Description: Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G1/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G1Â phase. Hypophosphorylates RB1 in early G1Â phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).
Target Description: Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G1/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G1Â phase. Hypophosphorylates RB1 in early G1Â phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).
Product Categories/Family for CDK4 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
cyclin-dependent kinase 4
NCBI Official Synonym Full Names
cyclin-dependent kinase 4
NCBI Official Symbol
Cdk4
NCBI Protein Information
cyclin-dependent kinase 4
UniProt Protein Name
Cyclin-dependent kinase 4
Protein Family
UniProt Gene Name
Cdk4
UniProt Entry Name
CDK4_RAT
NCBI Description
positive regulator of the cell cycle; plays a role in cell cycle progression [RGD, Feb 2006]
Research Articles on CDK4
Similar Products
Product Notes
The CDK4 cdk4 (Catalog #AAA3248158) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CDK4 Peptide - middle region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRTDRDIKVT LVFEHIDQDL RTYLDKAPPP GLPVETIKDL MRQFLSGLDF. It is sometimes possible for the material contained within the vial of "CDK4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
