Western Blot (WB)
(Host: RabbitTarget Name: CDK4Sample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Rat CDK4 Polyclonal Antibody | anti-CDK4 antibody
CDK4 Antibody - middle region
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDK4; Polyclonal Antibody; CDK4 Antibody - middle region; anti-CDK4 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDF
Sequence Length
303
Applicable Applications for anti-CDK4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat CDK4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CDK4Sample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CDK4Sample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDK4 antibody
Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G1/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G1Â phase. Hypophosphorylates RB1 in early G1Â phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).
Product Categories/Family for anti-CDK4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
cyclin-dependent kinase 4
NCBI Official Synonym Full Names
cyclin-dependent kinase 4
NCBI Official Symbol
Cdk4
NCBI Protein Information
cyclin-dependent kinase 4
UniProt Protein Name
Cyclin-dependent kinase 4
Protein Family
UniProt Gene Name
Cdk4
UniProt Entry Name
CDK4_RAT
NCBI Description
positive regulator of the cell cycle; plays a role in cell cycle progression [RGD, Feb 2006]
Research Articles on CDK4
Similar Products
Product Notes
The CDK4 cdk4 (Catalog #AAA3223543) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK4 Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK4 cdk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRTDRDIKVT LVFEHIDQDL RTYLDKAPPP GLPVETIKDL MRQFLSGLDF. It is sometimes possible for the material contained within the vial of "CDK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
