SDS-PAGE
Cyclin-dependent kinase 4 Recombinant Protein | CDK4 recombinant protein
Recombinant human Cyclin-dependent kinase 4 protein
Gene Names
CDK4; CMM3; PSK-J3
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase 4; Recombinant human Cyclin-dependent kinase 4 protein; CDK4 recombinant protein
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE-
Applicable Applications for CDK4 recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for CDK4 recombinant protein
Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G1/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G1 phase. Hypophosphorylates RB1 in early G1 phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
33.6 KD
NCBI Official Full Name
cyclin-dependent kinase 4
NCBI Official Synonym Full Names
cyclin-dependent kinase 4
NCBI Official Symbol
CDK4
NCBI Official Synonym Symbols
CMM3; PSK-J3
NCBI Protein Information
cyclin-dependent kinase 4
Protein Family
Research Articles on CDK4
Similar Products
Product Notes
The CDK4 (Catalog #AAA951914) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cyclin-dependent kinase 4 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the CDK4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ATSRYEPVAE IGVGAYGTVY KARDPHSGHF VALKSVRVPN GGGGGGGLPI STVREVALLR RLEAFEHPNV VRLMDVCATS RTDREIKVTL VFEHVDQDLR TYLDKAPPPG LPAETIKDLM RQFLRGLDFL HANCIVHRDL KPENILVTSG GTVKLADFGL ARIYSYQMAL TPVVVTLWYR APEVLLQSTY ATPVDMWSVG CIFAEMFRRK PLFCGNSEAD QLGKIFDLIG LPPEDDWPRD VSLPRGAFPP RGPRPVQSVV PEMEESGAQL LLEMLTFNPH KRISAFRALQ HSYLHKDEGN PE-. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
