Atg12 blocking peptide
Atg12 Peptide - C-terminal region
Gene Names
Atg12; Apg12l
Reactivity
Rat
Applications
Western Blot, Immunohistochemistry
Synonyms
Atg12; Atg12 Peptide - C-terminal region; Atg12 blocking peptide
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG
Sequence Length
141
Applicable Applications for Atg12 blocking peptide
Western Blot (WB), Immunohistochemistry (IHC)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Atg12 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Atg12 Antibody, made
Target Description: Atg12 is the ubiquitin-like protein required for autophagy. NP_001033584 is conjugated to ATG3 and ATG5.
Target Description: Atg12 is the ubiquitin-like protein required for autophagy. NP_001033584 is conjugated to ATG3 and ATG5.
Product Categories/Family for Atg12 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
ubiquitin-like protein ATG12
NCBI Official Synonym Full Names
autophagy related 12
NCBI Official Symbol
Atg12
NCBI Official Synonym Symbols
Apg12l
NCBI Protein Information
ubiquitin-like protein ATG12
UniProt Protein Name
Ubiquitin-like protein ATG12
Protein Family
UniProt Gene Name
Atg12
UniProt Synonym Gene Names
Apg12l; APG12-like
Uniprot Description
Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes. The ATG12-ATG5 conjugate also regulates negatively the innate antiviral immune response by blocking the type I IFN production pathway through direct association with RARRES3 and MAVS. Plays also a role in translation or delivery of incoming viral RNA to the translation apparatus ().
Research Articles on Atg12
Similar Products
Product Notes
The Atg12 atg12 (Catalog #AAA3239097) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Atg12 Peptide - C-terminal region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Atg12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the Atg12 atg12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TRTVQALIDF IRKFLRLLAS EQLFIYVNQS FAPSPDQEVG TLYECFGSDG. It is sometimes possible for the material contained within the vial of "Atg12, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
