Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (IHC Information: Paraffin embedded thyroid tissue, tested with an antibody Dilution of 5 ug/ml.)

Rabbit RYBP Polyclonal Antibody | anti-RYBP antibody

RYBP antibody - N-terminal region

Gene Names
RYBP; AAP1; DEDAF; YEAF1; APAP-1
Reactivity
Cow, Human, Mouse, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RYBP; Polyclonal Antibody; RYBP antibody - N-terminal region; anti-RYBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGT
Sequence Length
228
Applicable Applications for anti-RYBP antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Human: 100%; Mouse: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RYBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(IHC Information: Paraffin embedded thyroid tissue, tested with an antibody Dilution of 5 ug/ml.)

Immunohistochemistry (IHC) (IHC Information: Paraffin embedded thyroid tissue, tested with an antibody Dilution of 5 ug/ml.)

Western Blot (WB)

(WB Suggested Anti-RYBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-RYBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)
Related Product Information for anti-RYBP antibody
This is a rabbit polyclonal antibody against RYBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RYBP contains 1 RanBP2-type zinc finger. RYBP may be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1. In tumor cell lines, it may induce apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
RING1 and YY1-binding protein
NCBI Official Synonym Full Names
RING1 and YY1 binding protein
NCBI Official Symbol
RYBP
NCBI Official Synonym Symbols
AAP1; DEDAF; YEAF1; APAP-1
NCBI Protein Information
RING1 and YY1-binding protein
UniProt Protein Name
RING1 and YY1-binding protein
UniProt Gene Name
RYBP
UniProt Synonym Gene Names
DEDAF; YEAF1; APAP-1; DED-associated factor
UniProt Entry Name
RYBP_HUMAN

Uniprot Description

RYBP: Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes. May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1. May bind to DNA. Promotes apoptosis.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 3p13

Cellular Component: nucleoplasm; cytoplasm; PcG protein complex

Molecular Function: protein binding; DNA binding; zinc ion binding; transcription corepressor activity

Biological Process: transcription, DNA-dependent; apoptosis; multicellular organismal development; negative regulation of transcription from RNA polymerase II promoter

Research Articles on RYBP

Similar Products

Product Notes

The RYBP rybp (Catalog #AAA3204374) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RYBP antibody - N-terminal region reacts with Cow, Human, Mouse, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RYBP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RYBP rybp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTMGDKKSPT RPKRQAKPAA DEGFWDCSVC TFRNSAEAFK CSICDVRKGT. It is sometimes possible for the material contained within the vial of "RYBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.