Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Atg12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Rat Kidney)

Rabbit Atg12 Polyclonal Antibody | anti-ATG12 antibody

Atg12 antibody - C-terminal region

Gene Names
Atg12; Apg12l
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Atg12; Polyclonal Antibody; Atg12 antibody - C-terminal region; anti-ATG12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG
Sequence Length
141
Applicable Applications for anti-ATG12 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Atg12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Rat Kidney)

Western Blot (WB) (WB Suggested Anti-Atg12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Rat Kidney)
Related Product Information for anti-ATG12 antibody
This is a rabbit polyclonal antibody against Atg12. It was validated on Western Blot

Target Description: Atg12 is the ubiquitin-like protein required for autophagy. NP_001033584 is conjugated to ATG3 and ATG5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
ubiquitin-like protein ATG12
NCBI Official Synonym Full Names
autophagy related 12
NCBI Official Symbol
Atg12
NCBI Official Synonym Symbols
Apg12l
NCBI Protein Information
ubiquitin-like protein ATG12
UniProt Protein Name
Ubiquitin-like protein ATG12
Protein Family
UniProt Gene Name
Atg12
UniProt Synonym Gene Names
Apg12l; APG12-like

Uniprot Description

Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes. The ATG12-ATG5 conjugate also regulates negatively the innate antiviral immune response by blocking the type I IFN production pathway through direct association with RARRES3 and MAVS. Plays also a role in translation or delivery of incoming viral RNA to the translation apparatus ().

Research Articles on ATG12

Similar Products

Product Notes

The ATG12 atg12 (Catalog #AAA3214159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Atg12 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Atg12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the ATG12 atg12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TRTVQALIDF IRKFLRLLAS EQLFIYVNQS FAPSPDQEVG TLYECFGSDG. It is sometimes possible for the material contained within the vial of "Atg12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.