Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GTP-binding protein Rhes (Rasd2) Recombinant Protein | Rasd2 recombinant protein

Recombinant Rat GTP-binding protein Rhes (Rasd2)

Gene Names
Rasd2; Rhes
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GTP-binding protein Rhes (Rasd2); Recombinant Rat GTP-binding protein Rhes (Rasd2); Rasd2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-263, Full length protein
Sequence
MMKTLSSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEAELLVSGDENCAYFEVSAKKNTNVNEMFYVLFSMAKLPHEMSPALHHKISVQYGDAFHPRPFCMRRTKVAGAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKC
Sequence Length
263
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rasd2 recombinant protein
This gene encodes a Ras-related protein that enriched in striatum. The product of this gene binds to GTP and possesses intrinsic GTPase activity. The gene belongs to the Ras superfamily of small GTPases. The exact function of this gene is unknown, but most striatum-specific mRNAs characterized to date encode components of signal transduction cascades.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,197 Da
NCBI Official Full Name
GTP-binding protein Rhes
NCBI Official Synonym Full Names
RASD family, member 2
NCBI Official Symbol
Rasd2
NCBI Official Synonym Symbols
Rhes
NCBI Protein Information
GTP-binding protein Rhes
UniProt Protein Name
GTP-binding protein Rhes
Protein Family
UniProt Gene Name
Rasd2

NCBI Description

human homolog binds GTP and has GTPase activity and is also shows similarity to members of the Ras-like GTP-binding protein family [RGD, Feb 2006]

Uniprot Description

GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination.

Research Articles on Rasd2

Similar Products

Product Notes

The Rasd2 rasd2 (Catalog #AAA959695) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-263, Full length protein. The amino acid sequence is listed below: MMKTLSSGNC TLNVPAKNSY RMVVLGASRV GKSSIVSRFL NGRFEDQYTP TIEDFHRKVY NIHGDMYQLD ILDTSGNHPF PAMRRLSILT GDVFILVFSL DSRESFDEVK RLQKQILEVK SCLKNKTKEA AELPMVICGN KNDHSELCRQ VPAMEAELLV SGDENCAYFE VSAKKNTNVN EMFYVLFSMA KLPHEMSPAL HHKISVQYGD AFHPRPFCMR RTKVAGAYGM VSPFARRPSV NSDLKYIKAK VLREGQARER DKC. It is sometimes possible for the material contained within the vial of "GTP-binding protein Rhes (Rasd2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.