Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GALR1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellGALR1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human GALR1 Polyclonal Antibody | anti-GALR1 antibody

GALR1 antibody - C-terminal region

Gene Names
GALR1; GALNR; GALNR1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GALR1; Polyclonal Antibody; GALR1 antibody - C-terminal region; anti-GALR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRID
Sequence Length
349
Applicable Applications for anti-GALR1 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GALR1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellGALR1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-GALR1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellGALR1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-GALR1 antibody
This is a rabbit polyclonal antibody against GALR1. It was validated on Western Blot

Target Description: The neuropeptide galanin elicits a range of biological effects by interaction with specific G-protein-coupled receptors. Galanin receptors are seven-transmembrane proteins shown to activate a variety of intracellular second-messenger pathways. GALR1 inhibits adenylyl cyclase via a G protein of the Gi/Go family. GALR1 is widely expressed in the brain and spinal cord, as well as in peripheral sites such as the small intestine and heart.
Product Categories/Family for anti-GALR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
galanin receptor type 1
NCBI Official Synonym Full Names
galanin receptor 1
NCBI Official Symbol
GALR1
NCBI Official Synonym Symbols
GALNR; GALNR1
NCBI Protein Information
galanin receptor type 1
UniProt Protein Name
Galanin receptor type 1
Protein Family
UniProt Gene Name
GALR1
UniProt Synonym Gene Names
GALNR; GALNR1; GAL1-R; GALR-1
UniProt Entry Name
GALR1_HUMAN

NCBI Description

The neuropeptide galanin elicits a range of biological effects by interaction with specific G-protein-coupled receptors. Galanin receptors are seven-transmembrane proteins shown to activate a variety of intracellular second-messenger pathways. GALR1 inhibits adenylyl cyclase via a G protein of the Gi/Go family. GALR1 is widely expressed in the brain and spinal cord, as well as in peripheral sites such as the small intestine and heart. [provided by RefSeq, Jul 2008]

Uniprot Description

GALR1: Receptor for the hormone galanin. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q23

Cellular Component: plasma membrane; integral to membrane

Molecular Function: neuropeptide binding; protein binding; peptide hormone binding; galanin receptor activity

Biological Process: positive regulation of cortisol secretion; elevation of cytosolic calcium ion concentration; neuropeptide signaling pathway; digestion; negative regulation of adenylate cyclase activity; positive regulation of transcription from RNA polymerase II promoter; G-protein signaling, adenylate cyclase activating pathway

Research Articles on GALR1

Similar Products

Product Notes

The GALR1 galr1 (Catalog #AAA3216083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GALR1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GALR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GALR1 galr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLAYSNSSVN PIIYAFLSEN FRKAYKQVFK CHIRKDSHLS DTKESKSRID. It is sometimes possible for the material contained within the vial of "GALR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.