Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dexamethasone-induced Ras-related protein 1 (RASD1) Recombinant Protein | RASD1 recombinant protein

Recombinant Human Dexamethasone-induced Ras-related protein 1 (RASD1)

Gene Names
RASD1; AGS1; DEXRAS1; MGC:26290
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dexamethasone-induced Ras-related protein 1 (RASD1); Recombinant Human Dexamethasone-induced Ras-related protein 1 (RASD1); RASD1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-278, Full length protein
Sequence
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERC
Sequence Length
278
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RASD1 recombinant protein
This gene encodes a Ras-related protein that is stimulated by dexamethasone. The exact function of this gene is unknown, but it may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. In addition, studies of a similar rat protein suggest that it functions as as a novel physiologic nitric oxide (NO) effector. The gene product belongs to the Ras superfamily of small GTPases.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,848 Da
NCBI Official Full Name
dexamethasone-induced Ras-related protein 1 isoform 2
NCBI Official Synonym Full Names
ras related dexamethasone induced 1
NCBI Official Symbol
RASD1
NCBI Official Synonym Symbols
AGS1; DEXRAS1; MGC:26290
NCBI Protein Information
dexamethasone-induced Ras-related protein 1
UniProt Protein Name
Dexamethasone-induced Ras-related protein 1
UniProt Gene Name
RASD1
UniProt Synonym Gene Names
AGS1; DEXRAS1

NCBI Description

This gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with the neuronal nitric oxide adaptor protein CAPON, and a nuclear adaptor protein FE65, which interacts with the Alzheimer's disease amyloid precursor protein. This gene may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. Epigenetic inactivation of this gene is closely correlated with resistance to dexamethasone in multiple myeloma cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2011]

Uniprot Description

Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65 ().

Research Articles on RASD1

Similar Products

Product Notes

The RASD1 rasd1 (Catalog #AAA1423884) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-278, Full length protein. The amino acid sequence is listed below: MKLAAMIKKM CPSDSELSIP AKNCYRMVIL GSSKVGKTAI VSRFLTGRFE DAYTPTIEDF HRKFYSIRGE VYQLDILDTS GNHPFPAMRR LSILTGDVFI LVFSLDNRDS FEEVQRLRQQ ILDTKSCLKN KTKENVDVPL VICGNKGDRD FYREVDQREI EQLVGDDPQR CAYFEISAKK NSSLDQMFRA LFAMAKLPSE MSPDLHRKVS VQYCDVLHKK ALRNKKLLRA GSGGGGGDPG DAFGIVAPFA RRPSVHSDLM YIREKASAGS QAKDKERC. It is sometimes possible for the material contained within the vial of "Dexamethasone-induced Ras-related protein 1 (RASD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.