Ras-related protein Rab-8A (RAB8A) Recombinant Protein | RAB8A recombinant protein
Recombinant Chicken Ras-related protein Rab-8A (RAB8A)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ras-related protein Rab-8A (RAB8A); Recombinant Chicken Ras-related protein Rab-8A (RAB8A); RAB8A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-204, Full length protein
Sequence
MAKTYDYLFKLLLIGDSGVGKTCALFRFSEDAFNATFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIRNWVRNIEEHASPDVEKMILGNKCDANDKRQVSREQGEKLAASFGIKFMETSAKANINIENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKKSSFFRC
Sequence Length
204
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RAB8A recombinant protein
This protein is a member of the RAS superfamily which are small GTP
GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB
YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP
GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB
YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB
YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP
GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB
YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,522 Da
NCBI Official Full Name
ras-related protein Rab-8A
NCBI Official Synonym Full Names
RAB8A, member RAS oncogene family
NCBI Official Symbol
RAB8A
NCBI Protein Information
ras-related protein Rab-8A
UniProt Protein Name
Ras-related protein Rab-8A
Protein Family
UniProt Gene Name
RAB8A
Uniprot Description
May be involved in vesicular trafficking and neurotransmitter release.
Similar Products
Product Notes
The RAB8A rab8a (Catalog #AAA1317074) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-204, Full length protein. The amino acid sequence is listed below: MAKTYDYLFK LLLIGDSGVG KTCALFRFSE DAFNATFIST IGIDFKIRTI ELDGKRIKLQ IWDTAGQERF RTITTAYYRG AMGIMLVYDI TNEKSFENIR NWVRNIEEHA SPDVEKMILG NKCDANDKRQ VSREQGEKLA ASFGIKFMET SAKANINIEN AFFTLARDIK AKMDKKLEGN SPQGSNQGVK ITPDQQKKSS FFRC. It is sometimes possible for the material contained within the vial of "Ras-related protein Rab-8A (RAB8A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
