Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PSMD6Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PSMD6 Polyclonal Antibody | anti-PSMD6 antibody

PSMD6 Antibody - C-terminal region

Gene Names
PSMD6; S10; Rpn7; p42A; p44S10; SGA-113M
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PSMD6; Polyclonal Antibody; PSMD6 Antibody - C-terminal region; anti-PSMD6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDL
Sequence Length
351
Applicable Applications for anti-PSMD6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PSMD6Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSMD6Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PSMD6 antibody
This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants
Product Categories/Family for anti-PSMD6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
26S proteasome non-ATPase regulatory subunit 6 isoform 1
NCBI Official Synonym Full Names
proteasome 26S subunit, non-ATPase 6
NCBI Official Symbol
PSMD6
NCBI Official Synonym Symbols
S10; Rpn7; p42A; p44S10; SGA-113M
NCBI Protein Information
26S proteasome non-ATPase regulatory subunit 6
UniProt Protein Name
26S proteasome non-ATPase regulatory subunit 6
UniProt Gene Name
PSMD6
UniProt Synonym Gene Names
KIAA0107; PFAAP4
UniProt Entry Name
PSMD6_HUMAN

NCBI Description

This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]

Uniprot Description

PSMD6: Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. Belongs to the proteasome subunit S10 family.

Chromosomal Location of Human Ortholog: 3p14.1

Cellular Component: nucleoplasm; proteasome complex; proteasome regulatory particle; cytosol

Molecular Function: ATPase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; proteasomal ubiquitin-dependent protein catabolic process; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; proteolysis; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; negative regulation of apoptosis; G1/S transition of mitotic cell cycle

Research Articles on PSMD6

Similar Products

Product Notes

The PSMD6 psmd6 (Catalog #AAA3222020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMD6 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMD6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PSMD6 psmd6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVEFIDQELS RFIAAGRLHC KIDKVNEIVE TNRPDSKNWQ YQETIKKGDL. It is sometimes possible for the material contained within the vial of "PSMD6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.