Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAB8ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit RAB8A Polyclonal Antibody | anti-RAB8A antibody

RAB8A antibody - middle region

Gene Names
RAB8A; MEL; RAB8
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB8A; Polyclonal Antibody; RAB8A antibody - middle region; anti-RAB8A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP
Sequence Length
207
Applicable Applications for anti-RAB8A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rat: 85%; Sheep: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB8A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAB8ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAB8ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(RAB8A antibody - middle region validated by WB using 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab8A-GFP (15ug) at 1:1000.)

Western Blot (WB) (RAB8A antibody - middle region validated by WB using 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab8A-GFP (15ug) at 1:1000.)

Western Blot (WB)

(WB Suggested Anti-RAB8A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateRAB8A is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-RAB8A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateRAB8A is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-RAB8A antibody
This is a rabbit polyclonal antibody against RAB8A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RAB8A is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable.The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-RAB8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-8A
NCBI Official Synonym Full Names
RAB8A, member RAS oncogene family
NCBI Official Symbol
RAB8A
NCBI Official Synonym Symbols
MEL; RAB8
NCBI Protein Information
ras-related protein Rab-8A
UniProt Protein Name
Ras-related protein Rab-8A
Protein Family
UniProt Gene Name
RAB8A
UniProt Synonym Gene Names
MEL; RAB8
UniProt Entry Name
RAB8A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. [provided by RefSeq, Jul 2008]

Uniprot Description

RAB8A: May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. Interacts with MAP4K2 and SYTL4. Interacts with SGSM1 and SGSM3. Interacts with OPTN. Interacts with RAB3IP. Interacts with MYO5B. Interacts with PIFO/C1orf88. Interacts with BIRC6/bruce. Interacts with OCRL. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; Motility/polarity/chemotaxis; G protein, monomeric, Rab; G protein, monomeric; Oncoprotein

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: centrosome; cytoplasmic vesicle membrane; secretory granule membrane; recycling endosome membrane; nonmotile primary cilium; dendrite; postsynaptic density; phagocytic vesicle; cytosol; cilium; nucleoplasm; Golgi membrane; synaptic vesicle; trans-Golgi network transport vesicle; phagocytic vesicle membrane; cell soma; plasma membrane; nucleolus; nucleus

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; myosin V binding; protein kinase binding; Rab GTPase binding

Biological Process: regulation of long-term neuronal synaptic plasticity; metabolic process; organelle organization and biogenesis; protein secretion; regulation of protein transport; regulation of exocytosis; intracellular protein transport; synaptic vesicle exocytosis; axonogenesis; Golgi vesicle fusion to target membrane; cellular response to insulin stimulus; cilium biogenesis; mitotic cell cycle; Rab protein signal transduction; G2/M transition of mitotic cell cycle; vesicle docking during exocytosis

Research Articles on RAB8A

Similar Products

Product Notes

The RAB8A rab8a (Catalog #AAA3224515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB8A antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB8A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB8A rab8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIKFMETSAK ANINVENAFF TLARDIKAKM DKKLEGNSPQ GSNQGVKITP. It is sometimes possible for the material contained within the vial of "RAB8A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.