Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Peptide YY Recombinant Protein | PYY recombinant protein

Recombinant Human Peptide YY protein

Gene Names
PYY; PYY1; PYY-I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptide YY; Recombinant Human Peptide YY protein; PYY-I; PYY recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
31-64aa; Full Length
Sequence
IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Sequence Length
97
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for PYY recombinant protein
This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Product Categories/Family for PYY recombinant protein
References
Cloning and structural determination of human peptide YY cDNA and gene.Kohri K., Nata K., Yonekura H., Nagai A., Konno K., Okamoto H.Biochim. Biophys. Acta 1173:345-349(1993) Genomic organisation and localisation of the gene for the human peptide YY.Herzog H. Isolation and primary structure of human peptide YY.Tatemoto K., Nakano I., Makk G., Angwin P., Mann M., Schilling J., Go V.L.W.Biochem. Biophys. Res. Commun. 157:713-717(1988) A new molecular form of PYY structural characterization of human PYY(3-36) and PYY(1-36) .Eberlein G.A., Eysselein V.E., Schaeffer M., Layer P., Grandt D., Goebell H., Niebel W., Davis M., Lee T.D., Shively J.E., Reeve J.R. Jr.Peptides 10:797-803(1989) Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-alpha.Keane F.M., Nadvi N.A., Yao T.W., Gorrell M.D.FEBS J. 278:1316-1332(2011) The PP-fold solution structure of human polypeptide YY and human PYY3-36 as determined by NMR.Nygaard R., Nielbo S., Schwartz T.W., Poulsen F.M.Biochemistry 45:8350-8357(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6.1
NCBI Official Full Name
peptide YY preproprotein
NCBI Official Synonym Full Names
peptide YY
NCBI Official Symbol
PYY
NCBI Official Synonym Symbols
PYY1; PYY-I
NCBI Protein Information
peptide YY
UniProt Protein Name
Peptide YY
Protein Family
UniProt Gene Name
PYY
UniProt Synonym Gene Names
PYY
UniProt Entry Name
PYY_HUMAN

NCBI Description

This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa. [provided by RefSeq, Feb 2016]

Uniprot Description

PYY: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. Belongs to the NPY family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q21.1

Cellular Component: extracellular region; extracellular space

Molecular Function: G-protein-coupled receptor binding; hormone activity; neuropeptide hormone activity; protein binding

Biological Process: cell motility; cell proliferation; cell-cell signaling; cytoskeleton organization and biogenesis; digestion; eating behavior; feeding behavior; G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway; regulation of appetite

Disease: Obesity

Research Articles on PYY

Similar Products

Product Notes

The PYY pyy (Catalog #AAA963627) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-64aa; Full Length. The amino acid sequence is listed below: IKPEAPREDA SPEELNRYYA SLRHYLNLVT RQRY. It is sometimes possible for the material contained within the vial of "Peptide YY, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.