Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Purine-rich element-binding protein gamma (PURG) Recombinant Protein | PURG recombinant protein

Recombinant Human Purine-rich element-binding protein gamma (PURG)

Gene Names
PURG; PURG-A; PURG-B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Purine-rich element-binding protein gamma (PURG); Recombinant Human Purine-rich element-binding protein gamma (PURG); PURG recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-347, Full length protein
Sequence
MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD
Sequence Length
347
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PURG recombinant protein
The exact function of this gene is not known, however, its encoded product is highly similar to purine-rich element binding protein A. The latter is a DNA-binding protein which binds preferentially to the single strand of the purine-rich element termed PUR, and has been implicated in the control of both DNA replication and transcription. This gene lies in close proximity to the Werner syndrome gene, but on the opposite strand, on chromosome 8p11. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,572 Da
NCBI Official Full Name
purine-rich element-binding protein gamma isoform B
NCBI Official Synonym Full Names
purine rich element binding protein G
NCBI Official Symbol
PURG
NCBI Official Synonym Symbols
PURG-A; PURG-B
NCBI Protein Information
purine-rich element-binding protein gamma
UniProt Protein Name
Purine-rich element-binding protein gamma
UniProt Gene Name
PURG

NCBI Description

The exact function of this gene is not known, however, its encoded product is highly similar to purine-rich element binding protein A. The latter is a DNA-binding protein which binds preferentially to the single strand of the purine-rich element termed PUR, and has been implicated in the control of both DNA replication and transcription. This gene lies in close proximity to the Werner syndrome gene, but on the opposite strand, on chromosome 8p11. [provided by RefSeq, Apr 2016]

Research Articles on PURG

Similar Products

Product Notes

The PURG purg (Catalog #AAA1425705) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-347, Full length protein. The amino acid sequence is listed below: MERARRRGGG GGRGRGGKNV GGSGLSKSRL YPQAQHSHYP HYAASATPNQ AGGAAEIQEL ASKRVDIQKK RFYLDVKQSS RGRFLKIAEV WIGRGRQDNI RKSKLTLSLS VAAELKDCLG DFIEHYAHLG LKGHRQEHGH SKEQGSRRRQ KHSAPSPPVS VGSEEHPHSV LKTDYIERDN RKYYLDLKEN QRGRFLRIRQ TMMRGTGMIG YFGHSLGQEQ TIVLPAQGMI EFRDALVQLI EDYGEGDIEE RRGGDDDPLE LPEGTSFRVD NKRFYFDVGS NKYGIFLKVS EVRPPYRNTI TVPFKAWTRF GENFIKYEEE MRKICNSHKE KRMDGRKASG EEQECLD. It is sometimes possible for the material contained within the vial of "Purine-rich element-binding protein gamma (PURG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.