Proteasome activator complex subunit 3 (PSME3) Recombinant Protein | PSME3 recombinant protein

Recombinant Pig Proteasome activator complex subunit 3 (PSME3)

Cat. Num. AAA960189

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proteasome activator complex subunit 3 (PSME3); Recombinant Pig Proteasome activator complex subunit 3 (PSME3); PSME3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-254, Full length protein
• Sequence: ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
• Sequence Length: 253

• Species: Sus scrofa (Pig)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for PSME3 recombinant protein

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP
ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 47523754
• NCBI GeneID: 397625
• NCBI Accession #: NP_999513.1
• NCBI GenBank Nucleotide #: NM_214348.1
• UniProt Accession #: P61291
• Molecular Weight: 29,506 Da
• NCBI Official Full Name: proteasome activator complex subunit 3
• NCBI Official Symbol: PSME3
• NCBI Protein Information: proteasome activator complex subunit 3
• UniProt Protein Name: Proteasome activator complex subunit 3
• Protein Family: Proteasome activator
• UniProt Gene Name: PSME3
• UniProt Synonym Gene Names: PA28g; PA28gamma

Uniprot Description

Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition ().