Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Proteasome subunit beta type-9 (Psmb9) Recombinant Protein | Psmb9 recombinant protein

Recombinant Rat Proteasome subunit beta type-9 (Psmb9)

Gene Names
Psmb9; Lmp2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteasome subunit beta type-9 (Psmb9); Recombinant Rat Proteasome subunit beta type-9 (Psmb9); Psmb9 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-219, Full length protein
Sequence
TTIMAVEFDGGVVVGSDSRVSAGAAVVNRVFDKLSPLHQRIYCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANIVKNISYKYREDLLAHLMVAGWDQHEGGQVYGTMGGMLIRQPFAIGGSGSTYIYGYVDAAYKPGMTPEECRRFTTDAITLAMNRDGSSGGVIYLVTITADGVDHRVILGDELPKFYDE
Sequence Length
199
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Psmb9 recombinant protein
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP
ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding different isoforms have been identified; both isoforms are processed to yield the same mature subunit.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,324 Da
NCBI Official Full Name
proteasome subunit beta type-9
NCBI Official Synonym Full Names
proteasome subunit beta 9
NCBI Official Symbol
Psmb9
NCBI Official Synonym Symbols
Lmp2
NCBI Protein Information
proteasome subunit beta type-9
UniProt Protein Name
Proteasome subunit beta type-9
Protein Family
UniProt Gene Name
Psmb9
UniProt Synonym Gene Names
Lmp2; Ring12

NCBI Description

subunit of the proteasome complex, which may play a role in protein catabolism [RGD, Feb 2006]

Uniprot Description

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.

Research Articles on Psmb9

Similar Products

Product Notes

The Psmb9 psmb9 (Catalog #AAA956057) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-219, Full length protein. The amino acid sequence is listed below: TTIMAVEFDG GVVVGSDSRV SAGAAVVNRV FDKLSPLHQR IYCALSGSAA DAQAIADMAA YQLELHGLEL EEPPLVLAAA NIVKNISYKY REDLLAHLMV AGWDQHEGGQ VYGTMGGMLI RQPFAIGGSG STYIYGYVDA AYKPGMTPEE CRRFTTDAIT LAMNRDGSSG GVIYLVTITA DGVDHRVILG DELPKFYDE. It is sometimes possible for the material contained within the vial of "Proteasome subunit beta type-9 (Psmb9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.