Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BARD1 on HeLa cell. [antibody concentration 10ug/ml.)

Mouse anti-Human BARD1 Monoclonal Antibody | anti-BARD1 antibody

BARD1 (BRCA1-associated RING Domain Protein 1, BARD-1) (Biotin)

Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BARD1; Monoclonal Antibody; BARD1 (BRCA1-associated RING Domain Protein 1; BARD-1) (Biotin); anti-BARD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A11
Specificity
Recognizes human BARD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
777
Applicable Applications for anti-BARD1 antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa658-757 from human BARD1 (NP_000456) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BARD1 on HeLa cell. [antibody concentration 10ug/ml.)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BARD1 on HeLa cell. [antibody concentration 10ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged BARD1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BARD1 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-BARD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
580
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
BRCA1-associated RING domain protein 1 isoform 1
NCBI Official Synonym Full Names
BRCA1 associated RING domain 1
NCBI Official Symbol
BARD1
NCBI Protein Information
BRCA1-associated RING domain protein 1
UniProt Protein Name
BRCA1-associated RING domain protein 1
UniProt Gene Name
BARD1
UniProt Synonym Gene Names
BARD-1
UniProt Entry Name
BARD1_HUMAN

NCBI Description

This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

BARD1: the BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Plays a central role in the control of the cell cycle in response to DNA damage. Acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. Also forms a heterodimer with CSTF1/CSTF-50 to modulate mRNA processing and RNAP II stability by inhibiting pre-mRNA 3' cleavage. Colocalizes with BRCA1 into discrete subnuclear foci during S phase. Can translocate to the cytoplasm. Localizes at sites of DNA damage at double-strand breaks (DSBs); recruitment to DNA damage sites is mediated by the BRCA1-A complex. Defects in BARD1 gene are found in primary breast, ovarian and uterine cancers.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Ligase; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; BRCA1-BARD1 complex; cytoplasm; nucleolus; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; protein homodimerization activity; zinc ion binding; protein heterodimerization activity; RNA binding; ubiquitin-protein ligase activity; kinase binding; ligase activity

Biological Process: negative regulation of mRNA 3'-end processing; negative regulation of protein export from nucleus; regulation of phosphorylation; positive regulation of apoptosis; tissue homeostasis; positive regulation of protein catabolic process; protein ubiquitination; DNA repair; cell cycle arrest; response to DNA damage stimulus; negative regulation of apoptosis

Disease: Breast Cancer

Research Articles on BARD1

Similar Products

Product Notes

The BARD1 bard1 (Catalog #AAA6140788) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BARD1 (BRCA1-associated RING Domain Protein 1, BARD-1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BARD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BARD1 bard1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BARD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.