Photosystem I reaction center subunit PsaK (psaK) Recombinant Protein | Ava_2445 recombinant protein
Recombinant Anabaena variabilis Photosystem I reaction center subunit PsaK (psaK)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Photosystem I reaction center subunit PsaK (psaK); Recombinant Anabaena variabilis Photosystem I reaction center subunit PsaK (psaK); Recombinant Photosystem I reaction center subunit PsaK (psaK); Photosystem I reaction center subunit PsaK; Light-harvesting 6.8 kDa polypeptide Photosystem I subunit X; Ava_2445 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
9-86
Sequence
AATTPLEWSPTIGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAFGHILGVGIILGLHNLGRF
Sequence Length
86
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
8,909 Da
NCBI Official Full Name
photosystem I reaction center subunit X
NCBI Official Symbol
Ava_2445
NCBI Protein Information
photosystem I reaction center subunit X
UniProt Protein Name
Photosystem I reaction center subunit PsaK
UniProt Gene Name
psaK
UniProt Entry Name
PSAK_ANAVT
Uniprot Description
Subcellular location: Cellular thylakoid membrane; Multi-pass membrane protein
Probable HAMAP-Rule MF_00474.
Sequence similarities: Belongs to the PsaG/PsaK family.
Similar Products
Product Notes
The Ava_2445 psak (Catalog #AAA1178890) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 9-86. The amino acid sequence is listed below: AATTPLEWSP TIGIIMVIAN VIAITFGRQT IKYPSAEPAL PSAKFFGGFG APALLATTAF GHILGVGIIL GLHNLGRF. It is sometimes possible for the material contained within the vial of "Photosystem I reaction center subunit PsaK (psaK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
