Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WFDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)

Rabbit WFDC1 Polyclonal Antibody | anti-WFDC1 antibody

WFDC1 antibody - middle region

Gene Names
WFDC1; PS20
Reactivity
Dog, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WFDC1; Polyclonal Antibody; WFDC1 antibody - middle region; anti-WFDC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF
Sequence Length
220
Applicable Applications for anti-WFDC1 antibody
Western Blot (WB)
Homology
Dog: 86%; Human: 100%; Pig: 85%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WFDC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WFDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)

Western Blot (WB) (WB Suggested Anti-WFDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)
Related Product Information for anti-WFDC1 antibody
This is a rabbit polyclonal antibody against WFDC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.
Product Categories/Family for anti-WFDC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
WAP four-disulfide core domain protein 1 isoform 1
NCBI Official Synonym Full Names
WAP four-disulfide core domain 1
NCBI Official Symbol
WFDC1
NCBI Official Synonym Symbols
PS20
NCBI Protein Information
WAP four-disulfide core domain protein 1
UniProt Protein Name
WAP four-disulfide core domain protein 1
UniProt Gene Name
WFDC1
UniProt Synonym Gene Names
PS20
UniProt Entry Name
WFDC1_HUMAN

NCBI Description

This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. This gene is downregulated in many cancer types and may be involved in the inhibition of cell proliferation. The encoded protein may also play a role in the susceptibility of certain CD4 memory T cells to human immunodeficiency virus infection. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

WFDC1: Has growth inhibitory activity.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 16q24.3

Cellular Component: extracellular space

Molecular Function: serine-type endopeptidase inhibitor activity

Biological Process: negative regulation of cell growth; negative regulation of epithelial cell proliferation; negative regulation of inflammatory response; regulation of cell growth; response to drug; response to estradiol stimulus

Research Articles on WFDC1

Similar Products

Product Notes

The WFDC1 wfdc1 (Catalog #AAA3213408) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WFDC1 antibody - middle region reacts with Dog, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WFDC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WFDC1 wfdc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAEGIPNRGQ CVKQRRQADG RILRHKLYKE YPEGDSKNVA EPGRGQQKHF. It is sometimes possible for the material contained within the vial of "WFDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.