Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human Prolactin/PRL was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 30 kDa and 32 kDa.)

Prolactin/PRL Recombinant Protein | PRL recombinant protein

Recombinant Human Prolactin/PRL Protein

Gene Names
PRL; GHA1
Purity
>95% by SDS-PAGE.
Synonyms
Prolactin/PRL; Recombinant Human Prolactin/PRL Protein; GHA1; PRL recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM PB, 150 mM NaCl, pH7.4.
Sequence
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Sequence Length
227
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human Prolactin/PRL was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 30 kDa and 32 kDa.)

SDS-Page (Recombinant protein Human Prolactin/PRL was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 30 kDa and 32 kDa.)
Related Product Information for PRL recombinant protein
Description: Recombinant Human Prolactin/PRL Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Leu29-Cys227) of human Prolactin/PRL (Accession #P01236) fused with a 6xHis tag at the C-terminus.

Background: This protein belongs the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.
Product Categories/Family for PRL recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
prolactin
NCBI Official Synonym Full Names
prolactin
NCBI Official Symbol
PRL
NCBI Official Synonym Symbols
GHA1
NCBI Protein Information
prolactin
UniProt Protein Name
Prolactin
UniProt Gene Name
PRL
UniProt Synonym Gene Names
PRL
UniProt Entry Name
PRL_HUMAN

NCBI Description

This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]

Uniprot Description

prolactin: Prolactin acts primarily on the mammary gland by promoting lactation. Belongs to the somatotropin/prolactin family.

Protein type: Secreted; Cytokine; Secreted, signal peptide; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: extracellular region

Molecular Function: protein binding; prolactin receptor binding; hormone activity

Biological Process: lactation; cell proliferation; cell surface receptor linked signal transduction; regulation of multicellular organism growth; positive regulation of JAK-STAT cascade; female pregnancy

Research Articles on PRL

Similar Products

Product Notes

The PRL prl (Catalog #AAA9139868) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LPICPGGAAR CQVTLRDLFD RAVVLSHYIH NLSSEMFSEF DKRYTHGRGF ITKAINSCHT SSLATPEDKE QAQQMNQKDF LSLIVSILRS WNEPLYHLVT EVRGMQEAPE AILSKAVEIE EQTKRLLEGM ELIVSQVHPE TKENEIYPVW SGLPSLQMAD EESRLSAYYN LLHCLRRDSH KIDNYLKLLK CRIIHNNNC. It is sometimes possible for the material contained within the vial of "Prolactin/PRL, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.