Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Peroxisome proliferator-activated receptor alpha (PPARA) Recombinant Protein | PPARA recombinant protein

Recombinant Guinea pig Peroxisome proliferator-activated receptor alpha (PPARA)

Gene Names
Ppara; NR1C1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peroxisome proliferator-activated receptor alpha (PPARA); Recombinant Guinea pig Peroxisome proliferator-activated receptor alpha (PPARA); PPARA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-467, Full length protein
Sequence
MVDMESPLCPLSPLEAEDLESPLSEYFLQEMGTIQDISRSLGEDSSGSFGFPEYQYLGSGPGSDGSVITDTLSPASSPSSVSYPEVPCGVDEPPSSALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEVLTCDRDSEGAETADLKSLAKRIYEAYLKNFHMNKVKARIILAGKTSSHPLFVIHDMETLCTAEKTLMAKVVSDGIRDKEAEVRIFHCCQCVSVETVTNLTEFAKAIPGFASLDLNDQVTLLKYGVYEAIFTMLSSTMNKDGMLVAYGHGFITREFLKNLRKPFCDMMEPKFNFAMKFNALELDDSDISLFVAAIICCGDRPGLLNIDHIEKMQEAIVHVLKLHLQSNHPDDTFLFPKLLQKLADLRQLVTEHAQLVQVIKTESDAALHPLLQEIYRDMY
Sequence Length
467
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PPARA recombinant protein
Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta
delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,313 Da
NCBI Official Full Name
peroxisome proliferator-activated receptor alpha
NCBI Official Symbol
Ppara
NCBI Official Synonym Symbols
NR1C1
NCBI Protein Information
peroxisome proliferator-activated receptor alpha
UniProt Protein Name
Peroxisome proliferator-activated receptor alpha
UniProt Gene Name
PPARA
UniProt Synonym Gene Names
NR1C1; PPAR-alpha

Uniprot Description

Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. May be required for the propagation of clock information to metabolic pathways regulated by PER2 ().

Similar Products

Product Notes

The PPARA ppara (Catalog #AAA1260088) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-467, Full length protein. The amino acid sequence is listed below: MVDMESPLCP LSPLEAEDLE SPLSEYFLQE MGTIQDISRS LGEDSSGSFG FPEYQYLGSG PGSDGSVITD TLSPASSPSS VSYPEVPCGV DEPPSSALNI ECRICGDKAS GYHYGVHACE GCKGFFRRTI RLKLVYDKCD RSCKIQKKNR NKCQYCRFHK CLSVGMSHNA IRFGRMPRSE KAKLKAEVLT CDRDSEGAET ADLKSLAKRI YEAYLKNFHM NKVKARIILA GKTSSHPLFV IHDMETLCTA EKTLMAKVVS DGIRDKEAEV RIFHCCQCVS VETVTNLTEF AKAIPGFASL DLNDQVTLLK YGVYEAIFTM LSSTMNKDGM LVAYGHGFIT REFLKNLRKP FCDMMEPKFN FAMKFNALEL DDSDISLFVA AIICCGDRPG LLNIDHIEKM QEAIVHVLKL HLQSNHPDDT FLFPKLLQKL ADLRQLVTEH AQLVQVIKTE SDAALHPLLQ EIYRDMY. It is sometimes possible for the material contained within the vial of "Peroxisome proliferator-activated receptor alpha (PPARA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.