Proteasome subunit alpha type-1 Recombinant Protein | PSMA1 recombinant protein

Recombinant Human Proteasome subunit alpha type-1

Cat. Num. AAA952183

• Gene Names: PSMA1; NU; HC2; PROS30; HEL-S-275
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proteasome subunit alpha type-1; Recombinant Human Proteasome subunit alpha type-1; 30 kDa prosomal protein; PROS-30; Macropain subunit C2; Multicatalytic endopeptidase complex subunit C2; Proteasome component C2; Proteasome nu chain; PSMA1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-251aa; Partial
• Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD
• Sequence Length: 269

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PSMA1 recombinant protein

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome. Might be involved in the anti-inflammatory response of macrophages during the interaction with C. albicans heat-inactivated cells.

Product Categories/Family for PSMA1 recombinant protein

Immunology

References

The primary structures of four subunits of the human, high-molecular-weight proteinase, macropain (proteasome)

NCBI and Uniprot Product Information

• NCBI GI #: 4506179
• NCBI GeneID: 5682
• NCBI Accession #: NP_002777.1
• NCBI GenBank Nucleotide #: NM_002786.3
• UniProt Accession #: P25786; Q53YE8; Q9BRV9; A8K400
• Molecular Weight: 32.2 kDa
• NCBI Official Full Name: proteasome subunit alpha type-1 isoform 2
• NCBI Official Synonym Full Names: proteasome subunit alpha 1
• NCBI Official Symbol: PSMA1
• NCBI Official Synonym Symbols: NU; HC2; PROS30; HEL-S-275
• NCBI Protein Information: proteasome subunit alpha type-1
• UniProt Protein Name: Proteasome subunit alpha type-1
• Protein Family: Proteasome
• UniProt Gene Name: PSMA1
• UniProt Synonym Gene Names: HC2; NU; PROS30; PSC2; PROS-30
• UniProt Entry Name: PSA1_HUMAN

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009]

Uniprot Description

PSMA1: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome. Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells. Belongs to the peptidase T1A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.25.1; Proteasome complex; Protease

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: centrosome; cytosol; nucleoplasm; nucleus; polysome; proteasome complex; proteasome core complex

Molecular Function: protein binding; RNA binding; threonine endopeptidase activity

Biological Process: activation of MAPKK activity; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of peptide antigen via MHC class I; apoptosis; axon guidance; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; G1/S transition of mitotic cell cycle; gene expression; innate immune response; insulin receptor signaling pathway; MAPKKK cascade; mitotic cell cycle; negative regulation of apoptosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; nerve growth factor receptor signaling pathway; polyamine metabolic process; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; programmed cell death; protein polyubiquitination; Ras protein signal transduction; regulation of amino acid metabolic process; regulation of apoptosis; regulation of mRNA stability; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; small GTPase mediated signal transduction; stimulatory C-type lectin receptor signaling pathway; T cell receptor signaling pathway; tumor necrosis factor-mediated signaling pathway; vascular endothelial growth factor receptor signaling pathway; viral reproduction