Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipid phosphate phosphohydrolase 3 (PPAP2B) Recombinant Protein | PPAP2B recombinant protein

Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B)

Gene Names
PPAP2B; LPP3; VCIP; Dri42; PAP2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid phosphate phosphohydrolase 3 (PPAP2B); Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B); Recombinant Lipid phosphate phosphohydrolase 3 (PPAP2B); Lipid phosphate phosphohydrolase 3 EC= 3.1.3.4; PAP2-beta Phosphatidate phosphohydrolase type 2b Phosphatidic acid phosphatase 2b; PAP-2b; PAP2b Vascular endothelial growth factor and type I collage; PPAP2B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-311
Sequence
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM
Sequence Length
311
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,116 Da
NCBI Official Full Name
lipid phosphate phosphohydrolase 3
NCBI Official Synonym Full Names
phosphatidic acid phosphatase type 2B
NCBI Official Symbol
PPAP2B
NCBI Official Synonym Symbols
LPP3; VCIP; Dri42; PAP2B
NCBI Protein Information
lipid phosphate phosphohydrolase 3; PAP2 beta; phosphatidate phosphohydrolase type 2b; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible
UniProt Protein Name
Lipid phosphate phosphohydrolase 3
UniProt Gene Name
PPAP2B
UniProt Synonym Gene Names
LPP3; PAP-2b; PAP2b; VCIP
UniProt Entry Name
LPP3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010]

Uniprot Description

PPAP2B: Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P). The relative catalytic efficiency is LPA = PA > C-1-P > S-1-P. May be involved in cell adhesion and in cell-cell interactions. Belongs to the PA-phosphatase related phosphoesterase family.

Protein type: Lipid Metabolism - glycerophospholipid; Motility/polarity/chemotaxis; Membrane protein, multi-pass; Membrane protein, integral; Phosphatase, lipid; Lipid Metabolism - sphingolipid; EC 3.1.3.4; Lipid Metabolism - glycerolipid; Lipid Metabolism - ether lipid

Chromosomal Location of Human Ortholog: 1p32.2

Cellular Component: Golgi apparatus; adherens junction; membrane; plasma membrane; integral to membrane

Molecular Function: integrin binding; protein binding; phosphatidate phosphatase activity; lipid phosphatase activity; phosphoprotein phosphatase activity; sphingosine-1-phosphate phosphatase activity

Biological Process: blood vessel development; sphingolipid metabolic process; protein stabilization; sphingolipid biosynthetic process; regulation of Wnt receptor signaling pathway; gastrulation with mouth forming second; positive regulation of peptidyl-tyrosine phosphorylation; Bergmann glial cell differentiation; dephosphorylation; negative regulation of protein amino acid phosphorylation; phospholipid metabolic process; germ cell migration; homotypic cell-cell adhesion; positive regulation of transcription factor activity; lipid metabolic process

Research Articles on PPAP2B

Similar Products

Product Notes

The PPAP2B ppap2b (Catalog #AAA1090628) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-311. The amino acid sequence is listed below: MQNYKYDKAI VPESKNGGSP ALNNNPRRSG SKRVLLICLD LFCLFMAGLP FLIIETSTIK PYHRGFYCND ESIKYPLKTG ETINDAVLCA VGIVIAILAI ITGEFYRIYY LKKSRSTIQN PYVAALYKQV GCFLFGCAIS QSFTDIAKVS IGRLRPHFLS VCNPDFSQIN CSEGYIQNYR CRGDDSKVQE ARKSFFSGHA SFSMYTMLYL VLYLQARFTW RGARLLRPLL QFTLIMMAFY TGLSRVSDHK HHPSDVLAGF AQGALVACCI VFFVSDLFKT KTTLSLPAPA IRKEILSPVD IIDRNNHHNM M. It is sometimes possible for the material contained within the vial of "Lipid phosphate phosphohydrolase 3 (PPAP2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.