Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Paraoxonase 2 Recombinant Protein | PON2 recombinant protein

Paraoxonase 2, Recombinant, Human (PON2, Serum paraoxonase arylesterase 2, A-esterase 2, Aromatic esterase 2)

Purity
Highly Purified
~95% (SDS-PAGE). Single band on Western Blot.
Synonyms
Paraoxonase 2; Recombinant; Human (PON2; Serum paraoxonase arylesterase 2; A-esterase 2; Aromatic esterase 2); PON2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Highly Purified
~95% (SDS-PAGE). Single band on Western Blot.
Form/Format
Supplied as a liquid in PBS, 50% glycerol.
Sequence
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ.
Application Notes
Suitable for use as a positive control in Western Blot, ELISA, Immunoprecipitation and other immunological experiments. Other applications not tested
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 6 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for PON2 recombinant protein
Paraoxonase 2 (PON2) is a member of a multigene family whose genes share 65% identity at the amino acid level, and is expressed in a variety of tissues, including the pancreas. PON2 overexpression has been shown to lower the intracellular oxidative state and reduce the cells ability to oxidize LDL. PON2 is therefore implicated in the modulation of oxidative stress.

Recombinant Human Paraoxonase-2 is expressed in E. coli having a molecular weight of 43.5kD and fused to an amino terminal hexahistidine tag.
Product Categories/Family for PON2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43.5kD
NCBI Official Full Name
paraoxonase 2
NCBI Official Synonym Full Names
paraoxonase 2
NCBI Official Symbol
PON2
NCBI Protein Information
serum paraoxonase/arylesterase 2; PON 2; A-esterase 2; paraoxonase nirs; aromatic esterase 2; serum aryldialkylphosphatase 2
UniProt Protein Name
Serum paraoxonase/arylesterase 2
UniProt Gene Name
PON2
UniProt Synonym Gene Names
PON 2
UniProt Entry Name
PON2_HUMAN

NCBI Description

This gene encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded protein may also play a role in defense responses to pathogenic bacteria. Mutations in this gene may be associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

PON2: Capable of hydrolyzing lactones and a number of aromatic carboxylic acid esters. Has antioxidant activity. Is not associated with high density lipoprotein. Prevents LDL lipid peroxidation, reverses the oxidation of mildly oxidized LDL, and inhibits the ability of MM-LDL to induce monocyte chemotaxis. Belongs to the paraoxonase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.1.2; EC 3.1.1.81; Motility/polarity/chemotaxis; Hydrolase

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: mitochondrion; lysosome; extracellular region; plasma membrane; nucleus

Molecular Function: identical protein binding; arylesterase activity; metal ion binding

Biological Process: response to oxidative stress; aromatic compound catabolic process

Research Articles on PON2

Similar Products

Product Notes

The PON2 pon2 (Catalog #AAA636103) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. Suitable for use as a positive control in Western Blot, ELISA, Immunoprecipitation and other immunological experiments. Other applications not tested. Researchers should empirically determine the suitability of the PON2 pon2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGRLVAVGLL GIALALLGER LLALRNRLKA SREVESVDLP HCHLIKGIEA GSEDID ILPNGLAFFS VGLKFPGLHS FAPDKPGGIL MMDLKEEKPR ARELRISRGF DLASFNP HGISTFIDND DTVYLFVVNH PEFKNTVEIF KFEEAENSLL HLKTVKHELL PSVNDIT AVGPAHFYAT NDHYFSDPFL KYLETYLNLH WANVVYYSPN EVKVVAEGFD SAN GINISPDDKY IYVADILAHE IHVLEKHTNM NLTQLKVLEL DTLVDNLSID PSSGDIW VGCHPNGQKL FVYDPNNPPS SEVLRIQNIL SEKPTVTTVY ANNGSVLQGS SVASVY DGKLLIGTLY HRALYCELZ. It is sometimes possible for the material contained within the vial of "Paraoxonase 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.