Western Blot (WB)
(Host: RabbitTarget Name: ZRANB3Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Rabbit ZRANB3 Polyclonal Antibody | anti-ZRANB3 antibody
ZRANB3 Antibody - C-terminal region
Gene Names
ZRANB3; AH2; 4933425L19Rik
Reactivity
Cow, Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZRANB3; Polyclonal Antibody; ZRANB3 Antibody - C-terminal region; anti-ZRANB3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTSKKVQTISDCEKQAL
Sequence Length
1077
Applicable Applications for anti-ZRANB3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 83%; Horse: 88%; Human: 100%; Pig: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZRANB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ZRANB3Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ZRANB3Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-ZRANB3 antibody
This is a rabbit polyclonal antibody against ZRANB3. It was validated on Western Blot
Target Description: ZRANB3 is a DNA annealing helicase and endonuclease required to maintain genome stability at stalled or collapsed replication forks by facilitating fork restart and limiting inappropriate recombination that could occur during template switching events. It is recruited to the sites of stalled DNA replication by polyubiquitinated PCNA and acts as a structure-specific endonuclease that cleaves the replication fork D-loop intermediate, generating an accessible 3'-OH group in the template of the leading strand, which is amenable to extension by DNA polymerase. In addition to endonuclease activity, it also catalyzes the fork regression via annealing helicase activity in order to prevent disintegration of the replication fork and the formation of double-strand breaks. .
Target Description: ZRANB3 is a DNA annealing helicase and endonuclease required to maintain genome stability at stalled or collapsed replication forks by facilitating fork restart and limiting inappropriate recombination that could occur during template switching events. It is recruited to the sites of stalled DNA replication by polyubiquitinated PCNA and acts as a structure-specific endonuclease that cleaves the replication fork D-loop intermediate, generating an accessible 3'-OH group in the template of the leading strand, which is amenable to extension by DNA polymerase. In addition to endonuclease activity, it also catalyzes the fork regression via annealing helicase activity in order to prevent disintegration of the replication fork and the formation of double-strand breaks. .
Product Categories/Family for anti-ZRANB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
118kDa
NCBI Official Full Name
DNA annealing helicase and endonuclease ZRANB3 isoform 2
NCBI Official Synonym Full Names
zinc finger RANBP2-type containing 3
NCBI Official Symbol
ZRANB3
NCBI Official Synonym Symbols
AH2; 4933425L19Rik
NCBI Protein Information
DNA annealing helicase and endonuclease ZRANB3
UniProt Protein Name
DNA annealing helicase and endonuclease ZRANB3
Protein Family
UniProt Gene Name
ZRANB3
UniProt Synonym Gene Names
AH2
UniProt Entry Name
ZRAB3_HUMAN
Research Articles on ZRANB3
Similar Products
Product Notes
The ZRANB3 zranb3 (Catalog #AAA3219314) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZRANB3 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's ZRANB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZRANB3 zranb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YCEMCETPQG SAVMQIDSLN HIQDKNEKDD SQKDTSKKVQ TISDCEKQAL. It is sometimes possible for the material contained within the vial of "ZRANB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
