Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 20ug 293T cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:MUS81Submitted by:Anonymous)

Rabbit MUS81 Polyclonal Antibody | anti-MUS81 antibody

MUS81 antibody - C-terminal region

Gene Names
MUS81; SLX3
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MUS81; Polyclonal Antibody; MUS81 antibody - C-terminal region; anti-MUS81 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GETRGGGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGE
Sequence Length
551
Applicable Applications for anti-MUS81 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Human: 100%; Mouse: 79%; Pig: 83%; Rat: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 20ug 293T cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:MUS81Submitted by:Anonymous)

Western Blot (WB) (Lanes:Lane 1: 20ug 293T cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:MUS81Submitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-MUS81 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Western Blot (WB) (WB Suggested Anti-MUS81 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-MUS81 antibody
This is a rabbit polyclonal antibody against MUS81. It was validated on Western Blot

Target Description: MUS81 interacts with EME1 and EME2 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. It may be required in mitosis for the processing of stalled or collapsed replication forks.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
crossover junction endonuclease MUS81 isoform 2
NCBI Official Synonym Full Names
MUS81 structure-specific endonuclease subunit
NCBI Official Symbol
MUS81
NCBI Official Synonym Symbols
SLX3
NCBI Protein Information
crossover junction endonuclease MUS81
UniProt Protein Name
Crossover junction endonuclease MUS81
UniProt Gene Name
MUS81
UniProt Entry Name
MUS81_HUMAN

NCBI Description

This gene encodes a structure-specific endonuclease which belongs to the XPF/MUS81 endonuclease family and plays a critical role in the resolution of recombination intermediates during DNA repair after inter-strand cross-links, replication fork collapse, and DNA double-strand breaks. The encoded protein associates with one of two closely related essential meiotic endonuclease proteins (EME1 or EME2) to form a complex that processes DNA secondary structures. It contains an N-terminal DEAH helicase domain, an excision repair cross complementation group 4 (ERCC4) endonuclease domain, and two tandem C-terminal helix-hairpin-helix domains. Mice with a homozygous knockout of the orthologous gene have significant meiotic defects including the failure to repair a subset of DNA double strand breaks. [provided by RefSeq, Jun 2017]

Research Articles on MUS81

Similar Products

Product Notes

The MUS81 mus81 (Catalog #AAA3215217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUS81 antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MUS81 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MUS81 mus81 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GETRGGGHRP ELLRELQRLH VTHTVRKLHV GDFVWVAQET NPRDPANPGE. It is sometimes possible for the material contained within the vial of "MUS81, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.