Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ITGA1 Polyclonal Antibody)

Rabbit anti-Mouse, Rat ITGA1 Polyclonal Antibody | anti-ITGA1 antibody

ITGA1 Polyclonal Antibody

Gene Names
ITGA1; VLA1; CD49a
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ITGA1; Polyclonal Antibody; ITGA1 Polyclonal Antibody; CD49a; VLA1; integrin alpha-1; anti-ITGA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.97 mg/ml (varies by lot)
Sequence Length
1179
Applicable Applications for anti-ITGA1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ITGA1 (NP_852478.1).
Immunogen Sequence
ATVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFNLTDPENGPVLDDSLPNSVHE
Positive Samples
Mouse Kidney, Rat Lung
Cellular Location
Membrane, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ITGA1 Polyclonal Antibody)

Western Blot (WB) (Western blot-ITGA1 Polyclonal Antibody)
Related Product Information for anti-ITGA1 antibody
This gene encodes the alpha 1 subunit of integrin receptors. This protein heterodimerizes with the beta 1 subunit to form a cell-surface receptor for collagen and laminin. The heterodimeric receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. The alpha 1 subunit contains an inserted (I) von Willebrand factor type I domain which is thought to be involved in collagen binding.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 130kDa
Observed: 200kDa
NCBI Official Full Name
Integrin alpha-1
NCBI Official Synonym Full Names
integrin subunit alpha 1
NCBI Official Symbol
ITGA1
NCBI Official Synonym Symbols
VLA1; CD49a
NCBI Protein Information
integrin alpha-1
UniProt Protein Name
Integrin alpha-1
Protein Family
UniProt Gene Name
ITGA1
UniProt Entry Name
ITA1_HUMAN

NCBI Description

This gene encodes the alpha 1 subunit of integrin receptors. This protein heterodimerizes with the beta 1 subunit to form a cell-surface receptor for collagen and laminin. The heterodimeric receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. The alpha 1 subunit contains an inserted (I) von Willebrand factor type I domain which is thought to be involved in collagen binding. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGA1: Integrin alpha-1/beta-1 is a receptor for laminin and collagen. It recognizes the proline-hydroxylated sequence G-F-P-G- E-R in collagen. Belongs to the integrin alpha chain family.

Protein type: Membrane protein, integral; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q11.2

Cellular Component: neuron projection; focal adhesion; cell surface; membrane; plasma membrane; acrosome; perikaryon; integrin complex; lipid raft; external side of plasma membrane

Molecular Function: collagen binding; protein binding; metal ion binding; protein phosphatase binding; receptor binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; integrin-mediated signaling pathway; negative regulation of epidermal growth factor receptor signaling pathway; axon guidance; neutrophil chemotaxis; extracellular matrix organization and biogenesis; activation of MAPK activity; cell-matrix adhesion; vasodilation; negative regulation of cell proliferation; muscle contraction; cellular extravasation; positive regulation of neuron apoptosis; blood coagulation

Research Articles on ITGA1

Similar Products

Product Notes

The ITGA1 itga1 (Catalog #AAA9140692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGA1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ITGA1 itga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.